KEGG   Amphimedon queenslandica (sponge): 100633634Help
Entry
100633634         CDS       T02284                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00020  Citrate cycle (TCA cycle)
aqu00310  Lysine degradation
aqu01100  Metabolic pathways
aqu01200  Carbon metabolism
Module
aqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aqu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100633634
  Amino acid metabolism
   00310 Lysine degradation
    100633634
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100633634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H DUF4265
Motif
Other DBs
NCBI-GeneID: 100633634
NCBI-ProteinID: XP_019850565
Position
Unknown
AA seq 375 aa AA seqDB search
MFCLRGRELLPRLLHRHSSCLAPGKLRSNVVTASHIDSVSKSSKLSLPISSGSHHRLLAS
VLSPIKFQRFVSSSSILCNEYKIVNTPAFAESISEGDVKWDKNVGDFVKEDEIIAEIETD
KTAIPIPSPVFGIIEEIFVPDGEKVVAGDQLCKIKVSAEAPPPTASPPTPKESATPPPPP
PSPPSAPPPPSAPSAAGPIPTTPPPPPPLPTMPLGNIPPPPPLPSFSAPSQSVGVVSRSE
KRTKMSRMRQRIAERLKEAQNVNAMLTTFNEVDMSSVIELRKKFQDAFVKKHGIKLGFMS
PFVKAACSALEDQPVVNAVIDNNEIIYRDYIDISVAVATPKGLVVPVVRNVNVMNYADIE
KEIASLGQKVFSDAF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtctcagagggagagaactgctaccaaggctactccacaggcacagttcctgt
ctggctcctggaaagctaagatctaatgttgtgactgcttctcatattgattctgtttcg
aagtcgtcaaagttgagcttaccaattagctctggcagtcaccacaggctactggcttca
gtattatcacctataaagtttcaaagatttgttagctcttcgtcaattttgtgtaatgag
tataagatagttaatactcctgcatttgctgagtcaatctcggagggcgatgtaaagtgg
gacaaaaatgttggcgattttgttaaagaagacgaaattatagcagagattgaaactgat
aagactgctattcctataccttcccctgtgtttggaatcattgaagaaatatttgtacct
gacggggagaaagtggtagctggggaccagctatgcaaaataaaagtatcagctgaagca
cctcctccaacagcatcacctcctacacccaaagaaagtgccacacctcctcctccccct
ccttcccctccctctgctcctcctcctccttctgccccttctgctgctggtcctatacca
actacgcctcccccacctcctcctttaccaacaatgccattaggtaatattcctcctcct
cctcctcttccgtcattttctgctccctctcagtctgtgggtgtggtcagtcgttcggag
aaaagaacaaagatgtcaaggatgagacagaggatagccgagaggctcaaggaggcacag
aatgtcaatgcaatgctcaccactttcaacgaagtggacatgtctagcgtcattgagctt
aggaagaagtttcaagacgcatttgtaaagaagcatggtatcaagcttggattcatgtcg
ccatttgtaaaggcagcttgctcagcacttgaggatcaaccagtagtaaatgcagttatt
gataataatgaaatcatctatagagattacattgatatcagtgttgcagtagctacacca
aagggtttagttgttcctgttgtaagaaatgtcaatgttatgaattatgctgacattgaa
aaagagattgcaagcctgggacaaaaggtattttctgatgctttttga

DBGET integrated database retrieval system