KEGG   Amphimedon queenslandica (sponge): 100633848Help
Entry
100633848         CDS       T02284                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like isoform X1
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00450  Selenocompound metabolism
aqu00970  Aminoacyl-tRNA biosynthesis
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100633848
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100633848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aqu01007]
    100633848
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aqu03016]
    100633848
Enzymes [BR:aqu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100633848
Amino acid related enzymes [BR:aqu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100633848
Transfer RNA biogenesis [BR:aqu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100633848
 Prokaryotic type
   Other AARSs
    100633848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 100633848
NCBI-ProteinID: XP_019851278
UniProt: A0A1X7V0I0
Position
Unknown
AA seq 910 aa AA seqDB search
MASNSESVDGVSGCYGDPDVLKVAVLKELNPTIKVTFRKCTDENSKKSVSLLLSNGFCVT
AANEICRYLVKKEGGAVVSLRDWALIDYWLEWEAISLKPAILSSVINNSPSDQLLSCLTQ
LESHLTSNQKIVSCNEFSLADVVVWSTLLVIQSPESKLSSNIARDYPKIAQWYRSLARDS
RFSSAVWAASNDKGFEGFYDFIIPSGSGKSKSTTTGGKGQSSKAEKERTQSASGLSPSSS
TGDMIGQADIDKAMAHWNEGPDAAPKPRLHSHPILPIPGERNVLVTSALPYVNNVPHLGN
IIGCVLSGDVFVRYARLRNYNTLYVCGTDEYGTATEVKAVKEGLTPQQICDKYYALHSEI
YEWFNVDFDIFGRTSTPQQTQIAQDIFWHLYDRDLIKKDTVDQLLCTSCDKYLADRFVEG
ICPFCAYPDARGDQCDKCGKLINAVELKSPRCSICSSTPVVKQSNHLFLDLEKLQSPVFD
WAQKSISEGVWSQNAQFITKSWLRDGLKPRCITRDLKWGTPVPLEGYTDKVFYVWFDAPI
GYISITACYTDQWEKWWKNPEQVQLYQFMAKDNVPFHTVVFPSTLIGTGVDYSLLNHISS
TEYLNYEDGKFSKSRGVGVFGNNAVETGIPADIYRFYLLYVRPESQDSAFSWSDFVMKNN
SELLNNLGNFVNRTLSFIKSSFDSCIPVMTLSHDDSVIVVKVTQELQGYIECLERHKQRD
GLKHILAISRLGNGHIQAHKPWELVKGDKNQKLLAGSLLGLCANICCLISVLLQPYMPSI
SKEIQNQLQAPSECNIIWDYFVPYLPTGHKIGQPLPLFKKIDDATANELKKQFSGQKQDT
GASSAMGESSKSKLEAELAKQAEVVRSLKASGSATKETLDAEIAKLLELKKQLGISGASV
GSKKKGKKTK
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaattcagaatcagtagatggtgttagcgggtgttacggtgatcctgatgta
ctaaaggtggctgtactgaaggagctgaatcctacaatcaaagtgacatttagaaaatgt
acagatgaaaatagcaaaaagagtgtgtcactactgctgtcaaatggattttgtgtaaca
gctgctaatgagatatgtcggtatcttgttaagaaagaaggtggagctgtcgtctcattg
agagattgggctcttattgattactggctggaatgggaagctatttccttgaaaccagct
atcttgtcatcagtaattaataattcaccatcagatcaattgctatcatgtctgacacaa
ctcgagtctcatctcacaagtaatcagaagattgtctcatgcaatgagttctcattggct
gatgttgttgtatggtcaacactgctcgtaatacaaagccctgagtctaaactttcatcc
aatattgccagggattatccaaaaattgctcagtggtatcgctcgctggcacgggattct
cgattctcgtctgcagtctgggcagcatctaacgataaaggctttgaaggtttctatgac
ttcataatacctagtggatctggtaaatcaaagagcacaacaactggtggtaaaggacaa
agtagtaaagctgagaaggagagaacacaatctgctagtggtctgtcacccagcagtagt
actggtgatatgataggccaggctgatattgataaagccatggcccattggaacgaaggg
cctgatgctgcaccaaagcctcgtctacatagccatccaattttgcctatacctggtgaa
aggaatgttctagttacgagtgcattgccctatgtgaacaatgtgcctcatttaggtaac
attattggatgcgttttgagtggagatgtatttgtgagatatgctcgtcttcgtaattac
aacacactgtatgtgtgtggtactgatgagtatggcactgctactgaagtaaaggcagtc
aaagaaggactcactcctcagcagatatgtgacaagtactacgccctccattcggagata
tacgaatggtttaatgtggactttgacatatttggaaggaccagcacaccacagcaaaca
caaattgcccaggacattttctggcatctttatgacagagacctcattaagaaggacact
gtggatcagctactctgtacttcttgtgataagtatcttgctgatcgttttgtcgaaggg
atatgtccattctgtgcatacccagatgctcgtggggatcagtgtgataaatgtggaaag
ctgatcaatgccgttgaattgaaatctccacgttgcagcatatgctctagtacacctgta
gtgaagcaatccaaccatttgtttctggatcttgaaaagttgcaatctccagtatttgat
tgggcacaaaagtcaataagtgaaggagtttggtcacagaatgcccagttcattacaaag
tcctggttaagagatggtttgaagccgcgttgtataactcgtgatttgaagtggggcact
cctgtaccactggagggatacactgataaagtattctatgtttggtttgatgcccccatt
gggtatatatccatcactgcctgctatactgatcaatgggagaaatggtggaagaaccca
gaacaagtgcaactctatcagtttatggcaaaggataatgttcctttccacactgttgtc
tttcctagtacactcattgggactggtgtcgattactctctactgaaccacattagctca
acagagtatttgaattatgaagatgggaagttttccaagagtcgtggtgtgggcgtgttt
ggtaacaatgctgtagagactggtatcccagccgatatctatcggttctatctactgtat
gtgcggccagagtctcaggactctgcttttagctggtccgactttgttatgaagaacaac
agtgagctactcaataatcttgggaacttcgttaacaggacactctcgttcatcaagagc
agttttgattcttgcataccagtcatgacactcagccatgatgacagtgtgatagtagtt
aaagtaacccaagagctccagggatacattgagtgcttggagagacacaagcaacgcgat
ggactcaagcatatcctggctatatcccgactggggaatggacatatacaggctcacaag
ccgtgggaacttgtcaaaggagataagaatcagaagttgttggctgggagtcttcttgga
ttgtgtgctaatatttgttgcctcatttctgttctgctacagccatacatgccctccata
agtaaagagatacagaatcagttgcaggctcctagtgagtgcaatataatatgggattac
tttgttccgtatctaccaacaggacataaaattggacagccactgcctctgtttaagaag
atcgacgatgcaactgctaatgagctcaagaaacaatttagtggacagaaacaggatact
ggtgctagttctgctatgggcgagtcatcaaaaagcaaactggaagcggagttggctaaa
caagctgaagtggttcggtcgttgaaggcaagtggctctgctactaaagagacgcttgat
gctgaaattgcaaaacttcttgagttgaagaaacagcttgggatatcaggggccagtgtt
ggatcaaagaaaaagggaaagaaaacaaaatga

DBGET integrated database retrieval system