KEGG   Amphimedon queenslandica (sponge): 100634027
Entry
100634027         CDS       T02284                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00230  Purine metabolism
aqu00240  Pyrimidine metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100634027
   00240 Pyrimidine metabolism
    100634027
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100634027
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28
Other DBs
NCBI-GeneID: 100634027
NCBI-ProteinID: XP_003388261
Position
Unknown
AA seq 276 aa
MLLLKSFLISIASSKMAEVPAKKFCSSLGREIKIAVEGNIAAGKSTFLKILESHSTGYHV
IGEPLSRWTNIPSDDEDVTSSQQYGSNLLDMFYKDPKRYAYTFQTYACLSRLRAQLRDIP
QHLQSIPNPVIFYERSVYSDKFCFAQNCHESGLINDVEWSVYCDWHSFLIKYLHLEFDGF
IYLKSTPEVAMKRLKKRDRPEERGVTLDYLQSLHDKHNNWLIDNKTKLLPSVLQSDVPVL
VIDCDEDFEDSQENQKEILGKVDNFIDSILKATNDT
NT seq 831 nt   +upstreamnt  +downstreamnt
atgcttctcttaaaaagttttctaatctctatcgcttcttctaaaatggctgaggtccct
gccaagaagttttgctctagtctaggcagagaaataaaaatagctgtcgaaggaaacatt
gccgcgggtaagtcaactttccttaaaatactcgagtctcattcaactggttatcatgtg
attggggagcctttgagccgctggactaatataccatcagatgacgaggatgttacaagt
tcccagcagtacggcagtaacctcttagatatgttttataaagatcctaaacgttatgct
tatacctttcagacttatgcttgtttaagtcgtttaagagctcagttacgggatattccc
caacaccttcaaagtatacctaatcctgttatattttatgaacgatcagtttacagtgac
aaattttgttttgctcagaattgtcatgaaagtggtctcattaatgacgtggagtggtcc
gtctactgtgattggcattcatttctaattaaatatcttcatctggagtttgatggattt
atatatcttaagtcaactcccgaagttgcaatgaaaagactcaagaaaagagacagacca
gaggaacgtggggttacattggattacttgcagagtcttcatgataagcacaataactgg
ctgattgacaacaaaacaaagctattgccctcagtactacagagtgatgtgccagtccta
gtcattgactgcgatgaagactttgaggacagccaagagaaccaaaaggaaatattagga
aaagttgacaatttcattgactcgattttaaaagcgaccaatgatacatga

DBGET integrated database retrieval system