KEGG   Amphimedon queenslandica (sponge): 100634472Help
Entry
100634472         CDS       T02284                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100634472
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     100634472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 100634472
NCBI-ProteinID: XP_019848806
UniProt: A0A1X7VJ80
Position
Unknown
AA seq 437 aa AA seqDB search
MSSKGLSFIRGSSLCFSVRLSRSASTKAARQKIVVLGCGWGSYSVLRSVNKKKFDVICIS
PRNHFLFTPLLASTTVGTLEFRSIIEPIRNTGFRDEHHFHLSYATHLDHAQKVVQCRSAL
DPSMTYPVSYDILVIGVGANSSTFNIPGVNEHALFLKEIQDAREIRKRILTNFELATQPL
VSEEEKRRLLHFVVVGGGPTGVEFSAEFYDFLQQDLERLYPDERSTVHITLIEANEILSS
FDTKLRSYTEKIIKKRERMQILKASVTEVTDTGITLSDGSVMPCGMVVWSAGLAPRSFVN
DLNVDKNSRGQILVDEYLKLPSLDSVYAIGDCASVIGNDMPCTAQVAEKQGRYLAKALSR
KASTPPPPFVFKQTGMLAYIGDYRALADTSVGKSQGYASWILWRSAYSTKLGSWRLRMQV
PMDWMKTFFFGRDTSRF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaaaggactttcatttattcgaggctctagcttatgcttctcagttagactg
agccgttccgctagcacaaaggcagcaagacaaaaaatagtcgtccttggttgcggctgg
ggcagctattctgtcctccgctcagtaaataagaagaaatttgacgtcatttgcatcagc
ccaagaaaccacttcctattcacgcctctcctcgcaagcactacagtaggtaccctagaa
tttcgtagcattattgagccgattcgtaataccggttttagagatgaacatcattttcat
ctgtcttatgctactcatctcgaccacgcccaaaaagttgtccagtgtcgtagtgccctg
gacccatctatgacgtacccggtctcttacgatattcttgtgattggagtgggggctaat
tccagtacttttaatataccaggagttaatgaacacgccctctttcttaaagagattcaa
gatgcccgtgagatccgaaagaggatcctaactaactttgaattagcaacacagcctctc
gtctccgaagaagagaagagacgattgttacacttcgtggtggtaggagggggaccaact
ggagtggagtttagtgcagagttttatgacttcctccaacaagatcttgaacggttgtac
cctgatgaaagaagcacagttcatataacgttaattgaagcaaatgagatcctttcttcc
tttgatacaaagcttcgctcgtatacggaaaaaataattaaaaaaagagaaagaatgcaa
attctgaaagcatctgttactgaagtgactgatactggaattacattaagtgatggctca
gtgatgccttgtggtatggtagtatggtctgctggactagcaccaaggagttttgttaat
gatctaaatgtggataagaacagtcgaggacaaatattagtcgatgaatatttaaagtta
ccttcactagacagtgtctacgccattggagactgtgcttctgtaatcggcaatgacatg
ccttgtactgctcaagtcgctgaaaaacaaggccgttacttagctaaagcactctctcgt
aaagcttctactcctcctcctccctttgtcttcaagcagactgggatgttagcttacatt
ggagattatagagctttagctgatacgtcagttggaaaatcacaaggatatgcttcctgg
atattatggcgctcagcctacagcactaaacttggcagctggagattaagaatgcaggtt
cccatggactggatgaaaacattcttctttgggagagacacttcacgattttaa

DBGET integrated database retrieval system