KEGG   Amphimedon queenslandica (sponge): 100634482Help
Entry
100634482         CDS       T02284                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu03040  Spliceosome
aqu04141  Protein processing in endoplasmic reticulum
aqu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100634482
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100634482
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100634482
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aqu01009]
    100634482
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aqu03041]
    100634482
   03009 Ribosome biogenesis [BR:aqu03009]
    100634482
   03110 Chaperones and folding catalysts [BR:aqu03110]
    100634482
   04131 Membrane trafficking [BR:aqu04131]
    100634482
   03051 Proteasome [BR:aqu03051]
    100634482
   03029 Mitochondrial biogenesis [BR:aqu03029]
    100634482
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aqu04147]
    100634482
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100634482
Spliceosome [BR:aqu03041]
 Complex B
  Other components
   Prp19 complex
    100634482
 Complex C
   Prp19-CDC5 complex
    100634482
Ribosome biogenesis [BR:aqu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100634482
Chaperones and folding catalysts [BR:aqu03110]
 Heat shock proteins
  HSP70 / DNAK
   100634482
Membrane trafficking [BR:aqu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100634482
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100634482
Proteasome [BR:aqu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100634482
Mitochondrial biogenesis [BR:aqu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100634482
Exosome [BR:aqu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100634482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 100634482
NCBI-ProteinID: XP_011404208
UniProt: A0A1X7USZ6
Position
Unknown
AA seq 597 aa AA seqDB search
MASPAPAVGIDLGTCYSCVGVFQHGKVEIIPNDQGNRTTPSYVAFTDKERLIGDAAKNCI
TMNSINTVFGAKRLIGRKFNDPKVTADCKHWPFAVVNTDGRPKILVEYLGKTKTFYAEEV
SSMVLTKMRETAEAYLGKTVTDVVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAA
AIAYGLDKKVKEERNVLIFDLGGSNFSVSILTIEDGIFEVRSTSGNTHLGGEDFDSRMVD
YFMKEFQCKYMKDMSSNPHSLCRLRTACERAKRILSSSAQASIEIDSLFEGIDFYTTITR
ARFEELNNDLFYRILELVEKTLRDAKFYEGQIHDIVLVGGSTRIPKIQKLLQDFFNGKEL
NKSINPDEAVAYGAAVHAAILSGDKSEEVQDLILLDVAPLSLGIERAGGFFTALIKRNTT
IPKKEQETFTTYSDNQPSVLIQVYEGESFMTKDNNLLGKFELSGIPPAPRGVPQIQVTFD
IDRNSILNVSASDKSTGKEINITIMNDKGCLSAEEIERMVKEAEEFKAQDDKQRERIAAK
NSLEDYTFNMKSTMEDDKHLSAEEIDHTIRVFKAQDDNFDKQALNNFDKQALMLCTV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctagccctgcaccagctgtcggcatcgatctgggtacctgttactcctgtgtcggt
gtgttccagcacgggaaagtagaaatcatccccaacgaccaggggaacaggactacccct
agctatgtcgccttcactgacaaggagcgtctcattggagatgcagcaaagaactgtatc
accatgaattcgattaatacggtctttggtgccaagcgactcattggaaggaagttcaac
gatcctaaagtaaccgctgactgcaagcactggccatttgctgtcgttaacactgatggc
cgccctaagatcttagtagaatacttggggaagacaaagaccttctacgctgaagaggtg
tcctctatggtcctcactaaaatgagggagacagctgaggcttaccttgggaagactgtc
actgatgtagtcattacagtccctgcttacttcaatgactcacaacgtcaggcaacaaaa
gacgccggaaccatagctggtctcaacgtcctgcgtatcatcaacgagcccacagctgct
gccattgcctacggtctcgacaagaaagttaaagaagagaggaacgtcctcatctttgat
ttgggtggtagtaattttagtgtctccatccttacaattgaggacggcatatttgaagtg
aggtccacttccggcaacacacacttgggaggtgaggatttcgattctcgcatggttgac
tattttatgaaggaatttcaatgtaaatacatgaaggacatgtccagcaatccacattct
ctttgtcgtctcaggaccgcctgtgagagagctaagaggatcctctcctccagtgctcaa
gcatctattgagattgactctctctttgagggcattgacttctacactaccatcactcgt
gctcgttttgaagaactcaacaatgacctcttttatcgtatcctcgaactagttgagaag
acactccgtgatgctaaattctacgaaggtcaaatacatgatattgttctggttggtggc
tccactcgtatccctaagatccagaagctcctgcaggacttcttcaatgggaaggaactg
aacaagtccatcaatcctgatgaagctgttgcttatggagctgctgtccatgcagccatt
ttgagtggagacaagagtgaggaggtgcaagatctcattctccttgacgttgctcctctt
tctctcggtattgagagagcaggaggatttttcacagctctcattaaaaggaacactacc
atcccaaagaaagagcaagagaccttcacaacttactctgacaaccagccgagtgtcctt
atccaagtttatgaaggagaaagtttcatgaccaaggacaataatctccttggtaagttt
gagctctctggcatccctcctgctccccgtggagtgcctcagatccaggttacatttgat
atcgatcgtaatagtatcctcaatgtctctgcctctgacaagagtactggaaaagaaatc
aatatcaccatcatgaatgacaaaggatgtctctcagctgaggagatcgagcgtatggtc
aaggaagcagaagagtttaaggctcaagatgacaagcagagggaaaggattgctgccaag
aattcccttgaggactacacattcaacatgaagagcacaatggaagatgataaacatctc
tcagctgaagagattgatcatacaatcagggtgttcaaggctcaagatgacaactttgac
aagcaggcattgaacaactttgataagcaggcattgatgctttgtacagtttaa

DBGET integrated database retrieval system