KEGG   Amphimedon queenslandica (sponge): 100635508Help
Entry
100635508         CDS       T02284                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00561  Glycerolipid metabolism
aqu01100  Metabolic pathways
Module
aqu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100635508
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aqu01002]
    100635508
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100635508
Peptidases [BR:aqu01002]
 Serine Peptidases
  Family S33
   100635508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioesterase Peptidase_S9 Chlorophyllase2 PGAP1 Abhydrolase_2 Esterase Lipase_3 Abhydrolase_5 LIP Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 100635508
NCBI-ProteinID: XP_003383097
UniProt: A0A1X7VRP7
Position
Unknown
AA seq 484 aa AA seqDB search
MATTSEDLKEVPEGETASPEDPKKEGQSDQTSNSEVIATSGTNETSDQDQPNVDANTDNS
DVNQPNADTDQPNADADQPNADTDQPNADADQPNANTDQPNADADLPNTNADANQPNANA
DADQPNADADQPNTDANQPNADADQPNADANQPNADANQPNADADQPNADADPPNADADP
PNADADQPNADADQDPKEDTRRRSVYCNQPLETYIWKPEAQDIKGLVCICHGVHEHMGRY
EKLAEHLKSSGLLVFGIDLVGHGKSEGVRGSIDDMQSYATDVIGFAQEMEEKYPEQPMFL
MGHSMGGLVATIVAIQRQSMFIGLLLSAPSLMVDPNEAGPIKRLLARIIGAIAPNFGIST
LNTSTISSLPEEVAEYVNDPLIIHAPLKAGWGLAFMKGIQYVEGRLGDISIPLFIMHGSD
DQLVPMAASELVHNNASSTDKTLEVFIDCRHEILHDKEQDRARQLISTWILSRITSKQET
APDN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcaactacaagtgaagacttaaaggaggtaccagaaggagaaacagcctctcctgaa
gatcctaaaaaagaaggacaatctgaccagaccagtaactctgaagtgattgctaccagt
ggtactaatgaaacctctgatcaagatcaacccaacgttgatgctaacactgataactct
gatgtcaatcaacctaatgcagataccgatcaacctaatgctgatgccgatcaacctaac
gctgataccgatcaacctaatgctgatgccgatcaacctaacgctaatactgatcaacct
aatgctgatgctgatctacctaacactaatgctgatgccaatcagcctaatgctaatgct
gatgctgatcaacctaatgctgatgccgatcaacctaacactgatgccaatcaacctaac
gctgatgccgatcaacctaacgctgatgccaatcagcctaatgctgatgccaatcagcct
aatgctgatgccgatcagcctaatgctgatgctgatccacctaacgctgatgctgatcca
cctaatgctgatgccgatcaacctaacgctgatgctgatcaggatccaaaagaagataca
agaaggagaagtgtctattgcaatcaaccactggagacatatatctggaaaccagaagca
caagatataaagggattggtttgtatctgtcatggtgttcatgagcacatggggcgttat
gagaaactagccgaacacttaaaatcctcaggtctcttggtttttgggattgacttagtt
ggtcacggtaaaagtgaaggggttagaggatctattgatgatatgcaatcatatgcaacc
gatgtgattggatttgcacaagaaatggaagaaaaatacccagaacaaccaatgtttcta
atgggacactcaatgggcggcttggtagctaccatagttgctattcaaaggcagagcatg
ttcataggcctccttctctcagctccatcgctaatggtggatcctaatgaagcagggcct
ataaagagattgcttgcaaggatcattggagccattgcacctaattttggtatatcaact
cttaatacttctacaatttctagtcttccggaagaagttgcagagtatgttaatgatcca
ctgataatccacgctcctcttaaagccggttggggcttggctttcatgaaagggatacaa
tacgttgaaggaaggcttggggacatttcaattcctctgtttataatgcatggatctgat
gaccaacttgtcccaatggctgcgtctgaattggttcataataatgcttcaagcacagat
aaaacactagaggtgtttattgattgtcgtcatgaaatactccatgacaaagagcaagat
agagctcgtcagctcatctctacctggatattgagtagaattacaagcaagcaagaaaca
gcacctgataattaa

DBGET integrated database retrieval system