KEGG   Amphimedon queenslandica (sponge): 100636130Help
Entry
100636130         CDS       T02284                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aqu04131]
    100636130
Membrane trafficking [BR:aqu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100636130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2
Motif
Other DBs
NCBI-GeneID: 100636130
NCBI-ProteinID: XP_003391040
Position
Unknown
AA seq 789 aa AA seqDB search
RNSKLREQSVEVLRDLLASHDSDIRYTNFRSRISSIYLPLLSIVMDNYHRLYKGADGWEN
LTNTFDRNTEVRRSVVIKEGSDGSLEIDDEESRYDQILGPASTRNLLICFLWVLKNIDPM
LIKHWWSTLSISRLNLFLNVLDLCVACFEYKGKRNLMNQLSGASVATSKNSNNMKDQLAN
AILSGVGTAKERLQRRRQQSQDPAAGGSLRWGKTVWQAAAEYTEKLLKHCSSSMADVRAW
ACASLYLLMRQNYEIGQNFARVKVQVTVALSSIVAGSTKSFNEHHLRRSLKTLILYAEGD
DDMYQTSFPEQVKELAINLHRILLDTVKMKSFQNDHEMLMDLMYRISKGYQTSPDLRLTW
LQNMAKQHNEKDHYTESAMCLTHAAALVAEYLYMLDGSQHLPVGCVTFQKISPNMLEESA
ISDDVINPDEEGIATSRLFTESGLIGLLEQAAPMFRESQLYEAAAEIYKLVIPLYEHRRK
NHSLESVYNKLSDCYKSLAKKGDRRFLGSYFRVGFYGFWFGDLHMKEFIYKEEALMKLSE
FSLKLENLYSEQLGSEKVEIIKDSNEVDTSKLDGGKAYIQVTYVEPYFEDWELKKRLTVF
DKSFNIRRFSFSTPFTPGGKAHGELHNQWMKRTVLTTEKSFPYVKRRLEVIRTDTVKLKP
LEVAILNMESKIHELKAVLNRTPCDSKLLQMQLQGGIATAVNQGPFAIAKCFLEDVPLPE
QGYLHHKLKVCFKEFTKRCQEALERNEELIGEEQYDYQRELVKNFKNFQSQLQPMVSTQK
KMSHSKKAR
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
agaaactccaaattaagagaacaatcggttgaagtccttcgtgacctcttggccagtcat
gattcagatatcagatacaccaacttcagatcaagaatatcttcaatatatctaccacta
ctatcaattgtaatggacaactatcacagactttataagggtgctgatggttgggagaac
ctgacaaacacgtttgaccggaataccgaggtgcgtcgctcggttgtcattaaggaagga
agtgatgggtcactggagattgatgacgaggagagtaggtatgatcagatactgggtcct
gctagtacgagaaaccttttaatatgtttcctttgggttctgaagaacattgacccaatg
cttattaaacactggtggagtaccctctctatatcaaggctcaatctcttcctcaatgtt
cttgatttgtgtgttgcttgtttcgagtacaaaggaaaacgtaacctcatgaaccagctc
tcaggagcctcggtagcgaccagcaagaactcaaacaacatgaaagaccagctggctaac
gctatcctctctggagtgggtactgctaaggagagactccagaggaggagacagcagtca
caggatccagcagcaggtggatcacttcgctggggaaagaccgtgtggcaggcagcagct
gaatatactgagaaactcttgaagcactgtagctcatcaatggctgacgtgagggcgtgg
gcctgtgcttctctttatctactgatgagacaaaactatgagattggacaaaattttgct
cgagttaaagttcaagttacggttgctctctcttccattgttgctggttccacgaaatcg
ttcaatgagcatcatttgcgtcgatcattaaagacactgatactgtatgctgaaggagat
gatgatatgtatcagactagcttccctgaacaagtgaaggagcttgctattaatcttcat
cgtattctgttggatactgttaaaatgaagtcattccaaaacgatcatgagatgttaatg
gatctgatgtacagaatatccaaaggttatcaaacttctcctgatcttcgtctcacgtgg
ctacagaacatggccaagcagcacaacgagaaagatcactatactgagtcagcaatgtgt
ctcacccatgcagctgctctagtggcggagtacctgtatatgttagacgggtcacaacac
cttccggtcggctgcgtcacgtttcaaaaaatatcaccaaacatgttagaggagagtgca
atatctgatgatgtcattaatccagacgaggaaggtattgctaccagtagattattcact
gagtctggactcattggactattagaacaagcagctccaatgtttagagaatctcagtta
tatgaagcagctgctgagatatataagttagttattccgctgtacgagcacaggagaaag
aaccacagtttagagtcggtttataacaagctctcggactgttacaagagcttggcaaag
aaaggggacaggaggttccttgggagttacttcagggtcgggttttatggtttctggttc
ggagaccttcacatgaaagagtttatatacaaagaggaggctctaatgaaactgagcgaa
ttctctttaaaactagagaacctttacagcgagcagttaggttctgaaaaggttgagatc
atcaaagactcaaacgaggtcgacacttcaaaacttgatggaggaaaggcctacatacag
gtgacatatgtagagccgtatttcgaggactgggaacttaagaagagactaacagtattt
gacaaatcattcaacatcagacgtttctccttcagtaccccattcacaccaggtggtaaa
gctcatggtgaactccacaatcaatggatgaaaaggacggtactcaccactgagaagagt
ttcccgtacgttaaaaggcgtctggaggtcataaggactgatactgttaagcttaaacct
cttgaggtagccattttgaatatggaatcaaaaatacacgaactgaaggctgtcctcaat
cgtactccttgcgattcaaaattacttcaaatgcagctgcaaggaggaatagctacagct
gttaaccagggtccatttgcgattgctaaatgtttcctagaggatgttcctctacctgaa
cagggatatcttcatcataaactcaaagtttgcttcaaagaattcaccaaacgttgtcaa
gaagctcttgaaaggaatgaggaactgattggtgaggagcagtacgactatcagagagaa
cttgtgaagaatttcaagaacttccagagtcagctacaaccaatggtcagcacacaaaag
aagatgagtcattcaaagaaagcaaggtaa

DBGET integrated database retrieval system