KEGG   Amphimedon queenslandica (sponge): 100636465Help
Entry
100636465         CDS       T02284                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1-like isoform X1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00051  Fructose and mannose metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100636465
Enzymes [BR:aqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     100636465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MAAL_C MR_MLE_N PepSY
Motif
Other DBs
NCBI-GeneID: 100636465
NCBI-ProteinID: XP_019856287
UniProt: A0A1X7U436
Position
Unknown
AA seq 458 aa AA seqDB search
MAPLFSRLKTLLSRDVIISSLTARDVRFPTSACGTGHGSDALHKDPNYSAAYAVLTAASS
NSEGGSLYSGHGLTFTIGRGNEVVCAAIKSLEPLVVGRSLVDIFTDFASFWHSLTCETQL
RWIGPEKGAIHLAVAAVINALWDLWGKIECKPVWELLSDMSPEEIISLIDWQYLSDAITK
DEALAILHKQYPSRRERVEDLKENGYPAYITSAGWMGYSDEVVEERLQSALKSGFTKFKM
KVSRDLSVDKHRCELIRSILGPNVPLMMDANQCWDVDEAIAHMTALSVYKPLWIEEPTSP
DDILGHAKIGRALRPLGIGIATGEHCHNRVMFKQFLESGAMDYCQIDSCRLGGINEIIAV
LLLAEKFKVPVCPHAGGCGLCEMVQHLMFFYYICISGSKESRLIEYADHLHEHFVHPVTV
NNGCYLLPTSAGYSTEMKKESVEEYSYPNGPAWTKTIS
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctcccttattctccagattgaaaaccctcctttcacgtgatgttatcatttcttct
ctcactgctagagatgtaaggttcccaacttcagcctgtggaacaggtcatggctctgac
gctctacacaaagaccctaactattcagcagcttatgcagttttgactgcagctagcagc
aatagtgaaggaggcagtctttatagtggccatggattaacgttcacaataggccgtgga
aatgaggttgtttgtgctgcaataaaatcactggagccgctagtagttggtagatcactg
gtcgatatatttactgactttgcttcgttttggcacagtctgacgtgtgagacacaactc
cgctggataggaccagagaaaggagcaatacacctagcagtagctgcagtcattaatgca
ctgtgggacctctggggtaagatagagtgtaaaccagtctgggagctattatcagacatg
agtcccgaggagattatatcgctaattgattggcagtatctctctgatgctattacaaag
gatgaagcactagcaatactacacaagcagtatccttcacgtagagagagggtggaagat
ttaaaagagaatggatatccagcttacattacatcagctggctggatggggtacagtgat
gaggttgtagaggagcgacttcagtctgctttaaagtctggtttcactaaattcaagatg
aaagtctctcgtgatctctcagttgataagcatcgctgtgagctgattcgttcaattctt
ggtcccaacgttccactgatgatggatgctaatcaatgctgggatgtggatgaagcaata
gctcacatgacagctctatcagtgtataagccattatggatagaagagcccacatctcct
gatgatatactgggccatgctaagattggtagggcattgcgtccactgggcattggtata
gctactggagagcattgtcacaatcgtgtgatgttcaagcagtttttagagtcaggagct
atggactactgtcagattgatagctgtagattaggaggcatcaatgagatcatagctgtc
ctattgctagctgagaagttcaaagtccctgtctgccctcatgctggtggatgtgggctc
tgtgaaatggtccagcacttaatgttcttttactacatatgtatatctggtagtaaagag
agccgactcatcgaatatgctgatcacctccacgagcactttgtgcatccagtcactgtt
aataatggatgctatcttttgcccactagtgcagggtactctactgaaatgaagaaagag
tcagtagaagaatattcctatcctaatggacctgcatggaccaagacaatatcttaa

DBGET integrated database retrieval system