KEGG   Amphimedon queenslandica (sponge): 100637153Help
Entry
100637153         CDS       T02284                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-1B-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu04068  FoxO signaling pathway
aqu04144  Endocytosis
aqu04350  TGF-beta signaling pathway
aqu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100637153
   04068 FoxO signaling pathway
    100637153
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100637153
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100637153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aqu01001]
    100637153
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100637153
Protein kinases [BR:aqu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100637153
Cytokine receptors [BR:aqu04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   100637153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr FTA2
Motif
Other DBs
NCBI-GeneID: 100637153
NCBI-ProteinID: XP_019860622
Position
Unknown
AA seq 549 aa AA seqDB search
MLRFLTFLFLFLSCITVSLSNRLCYGTYDTSDNDAYNNDNGTCSFQPPRDYCFFAINNHK
IVTRGCSQRNPGDIGTLICLNHWIYDPINNRSLYCCQGNYCNECPDIEELCEEYAQVTSL
LNVTNPPSECNTNLLTCASSSSISMTSTPGISLSQTPSSSVTVSSTPTPTPNGLSQTYIV
FISATSTFLFILILIIVGFFVFSCITRGRRRDPSDHIIEITDVSSSGVSSSLRGPRLLQQ
RTMSHDVTKISVIGQGRFGKVWRCSYEEKHIAMKVFKNMHMAVFKREVEIYDTYMLYHEN
ILRFIGHDQIEFADTIELRLYTEYHENGTLQDYLKSKPVFHFPECHQMAVSLSSGLTYLH
KTIVAGKIKPGIAHRDLKSSNILVKTDYTLCIADLGLAIKQSESGDGVDQIPANKLSGTK
RYMSPEILNESLDYGRFICYAQSDIYSFSLIIWEIFNCCEIDGVPRSYQLPYCEWVPTDP
DIDQMKQCVCVNNRRPTIPDSWTESETLSPIAKLLDSSWATQASSRISALRISKILKGID
FKKEKIQNE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtttcttaactttcctttttctgtttctctcttgtattactgtatcattgagt
aatagactatgttatggtacatatgatacaagtgataatgatgcatataataatgataac
ggtacctgttcattccaacctccacgtgactactgcttctttgcaattaataaccataaa
atagttaccagaggctgtagtcagagaaatccaggtgacattggtactttaatttgtctc
aatcactggatatatgatcccattaataacagatcattatattgctgtcaaggcaactat
tgtaatgaatgtccagatattgaggaattatgtgaggagtatgctcaagttacaagtcta
ctgaatgtcactaatcctccttctgaatgtaataccaatcttcttacctgtgcttcttct
agttctatctcaatgactagtactcctgggatttcattgtctcaaaccccttcttcatca
gttactgtgtccagtacacccacccctacccccaatggcttatcacagacgtacatcgtc
tttatttcagccacaagcacctttttatttatactgatactgataattgttgggtttttt
gtgttctcgtgtattactcgtggaaggaggagagatccttcagatcacattatagagatc
actgacgtctcttcttctggtgtcagcagcagtctaagagggccacgccttctccaacag
agaacaatgtcgcatgatgtgacaaagatcagtgtcattggacagggacgttttggaaaa
gtctggcggtgttcttatgaagagaagcacatagcgatgaaagtctttaagaatatgcac
atggctgtcttcaagagggaagtggagatctatgacacatatatgctgtatcatgagaac
atactcagattcataggccacgatcaaatcgaatttgctgataccatagaactacgactt
tacactgagtatcacgaaaatggaactctacaggattatctaaagtccaagcctgttttt
cattttcctgaatgtcaccaaatggccgtttctctctcatctggacttacatatctacat
aaaacgatagttgctggtaaaataaaacctggtattgcacacagggatttaaagtccagt
aacatattagttaaaacagactacactctctgtatagctgatcttggtttggcaataaaa
cagagtgagagtggagatggtgttgaccagatacctgccaacaagctgtcaggcactaaa
agatacatgtctcctgagatactaaatgagagcttagactatggacgctttatatgctat
gcacagtcggacatttactccttctctcttataatttgggagattttcaattgctgtgaa
attgacggcgtcccacgctcttatcaactgccttactgtgaatgggttcccacagatcca
gatatcgatcaaatgaaacaatgtgtatgcgtgaacaatagaaggcctaccatacctgat
tcttggacagagagtgaaactttgagtcctatagcgaagttgctagacagttcctgggca
actcaagcatcaagcagaatatctgcattaagaatatcaaaaattttaaaaggaatcgac
tttaaaaaagaaaagatacaaaatgaataa

DBGET integrated database retrieval system