KEGG   Amphimedon queenslandica (sponge): 100638755Help
Entry
100638755         CDS       T02284                                 

Definition
(RefSeq) general transcription factor 3C polypeptide 4-like
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aqu01001]
    100638755
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100638755
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100638755
Protein kinases [BR:aqu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100638755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIIC_delta zf-TFIIIC
Motif
Other DBs
NCBI-GeneID: 100638755
NCBI-ProteinID: XP_019857251
Position
Unknown
AA seq 684 aa AA seqDB search
MAAKLLLECCRKEAVPSFPPSFFPTGSLSWSTDDRISLVCSDVIYVITLKGFLPQNTKSL
VPISVAIIEAPPMSFPLSLNLSLDISKCIYGEHTPSNEGHSPFNEGPLVDGVFGVLFDPL
VSGCGSKGRFLSAKWSPIRSNWSNRCILAGLTNSSSVLVYDETTRGQWDLVFDFTDIYYR
VLVSVDFDVKLLPATSEQSPPPTTKTNISQSEYQRRRDFFVSVAMSWLPVFLSEGVVLLA
IAMRSGHLVLWSMAVPVDRLVPPSLLNVIHLPAGISSVTTVEWTIINKNYLLSVGSASGH
VLLLEWVESAFPYEEPMVYHIWSCNDEVPVGHMTWSCSEDVKWLIYSKGCYTFAVLIKYM
NNELMTSDPYLLSSNHTHPVSGITSLHNNDVITCSTDGTITSRPLPNMEGVTVGASASDT
VINGKEEWSPVSLGGKITAGSCFGMDSSKNDLYTIIHVKTVDKVSTQLLILPLILPEDVS
LIWQRSSSWDLYESLRSNLSLIYEEGETRIESLPLAMRRHAAALSHDQELMFQIDGELLS
QHCRRYLSEFMKWTEDNEIQNGDKSIISIGNTAALLKRHAQNEFDFSIAENCLSFVVNNL
AQVEKCPICSEIILYCNPLSGSCSNNHCWERCVLTQCIVSQFAESMSCSICNKLVNITRG
GWLGHVLKTFTICPICGGHFESTL
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaactgctccttgaatgctgtagaaaggaagccgttccctccttccctccc
tccttcttccccaccggctctctctcctggtctactgatgacagaatatctctagtctgc
agtgatgtcatttacgttattactcttaaaggttttctgcctcaaaataccaagtcctta
gttccgatatcagttgccattattgaagctcctcccatgtcctttcctctttctcttaat
ctatcactagacattagtaaatgtatttatggagaacacaccccctctaatgagggacac
tccccctttaacgagggacctttggttgatggtgtgtttggtgttttatttgatcctttg
gttagtgggtgtggctctaaaggtcgtttcttatcagcaaagtggtcgccgatcagatca
aactggtcaaacaggtgtattttggcaggtctgactaactccagtagtgtattagtttat
gatgagacaacgaggggacaatgggacttggtgtttgattttactgatatttattataga
gtattagtctctgttgattttgatgtcaaactcttaccagcaacatcagaacaatcacct
cctcctactacaaaaactaatatttctcaatctgaatatcagagacggcgtgatttcttt
gtatccgtggcaatgtcatggttaccggtcttcctttcagagggtgtggtcttacttgct
atagctatgagaagtggtcacttggttctatggtcaatggctgtaccagtagacaggcta
gtgcctccgtccttactgaacgtgattcatttaccagctgggatcagttcagttacaact
gtagagtggacaatcattaataaaaattatttattaagtgtcgggtcagccagtgggcat
gtcctcttattagagtgggtggagtctgcctttccttatgaggaacctatggtataccat
atatggagttgcaatgatgaggtaccagttggtcacatgacctggagctgttctgaggat
gtgaaatggttaatatattccaaaggttgttatacttttgctgttttaattaaatatatg
aataacgagctaatgacatcagatccttatcttctctcatcaaaccacacccatcccgtc
tctggaatcacctcattacacaataatgatgtcataacgtgttcaactgatggaactatt
acctctcgtcctttaccaaatatggaaggtgtaacggttggggcttcagccagtgataca
gttattaatggtaaggaggaatggagtccagttagtcttggagggaagattacagctgga
tcctgttttggaatggactcgtctaaaaatgacctttacactatcatacatgttaaaact
gtcgacaaggtttcaacccagctcctaatcctccctctcatactgccagaggatgtcagt
ctgatatggcagcgctcgtcatcttgggatctttatgagtccttgaggagtaatttatca
cttatttacgaggagggagagacaaggattgaatcattaccactagccatgaggagacat
gcagctgcactctctcatgatcaagagctgatgtttcagattgatggagaactgctgagt
cagcattgcagacgttacttgagtgagttcatgaaatggacagaagacaatgaaattcaa
aatggagacaagtcgataatttccattggtaacactgctgctttactgaaacgacatgca
caaaatgagtttgatttttcaatagccgaaaattgtttatcattcgtggtcaataatttg
gcacaagttgagaagtgtcctatttgtagcgaaatcatactgtattgcaacccactttca
gggtcatgctccaataatcattgctgggagaggtgtgtcctaactcagtgtattgtgtct
caatttgctgagtccatgagttgttcgatctgtaacaaactagttaatataaccagaggt
ggctggctaggacacgttttgaagacatttacaatctgtcctatttgtggaggccatttt
gaatcaacactttaa

DBGET integrated database retrieval system