KEGG   Amphimedon queenslandica (sponge): 100638922Help
Entry
100638922         CDS       T02284                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aqu04131]
    100638922
Membrane trafficking [BR:aqu04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    100638922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 zf-RING_5 Vps39_1 WD40 ANAPC4_WD40 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 100638922
NCBI-ProteinID: XP_003382724
UniProt: A0A1X7VUG2
Position
Unknown
AA seq 912 aa AA seqDB search
MEADEVSSYEEEEGSTSGEEAEDGEEEEEDDDEDEEPLLKYSRFAKDVVNSLSQMPSNTT
EGEPKNVIVCMAVHPKFIALGTYDGTVKLLDHTGTVLADREYRLHIAQINHISVDQEGDF
MACCSNDGKVSIVGLFTAKYNNSVQFERAVKSVAIHPHFGKSTNRMFAIGIDKVLLVEER
RWPLIGYKNTEIHSGYGIVEVIKWRDNYMAWANEKTVFAYNVATKSLITCIRFDEESPIS
LPCSLCWVKNGLLLVGRGHIVKVAEVREVTENVVLMDGYASGVEAQPAKKKELMKISAQN
MFPNFLVCGVVPIMNRDKSWNMVVLGYDAHINQEEAIHKGTVPPPHLIVRPPAMYLPDSE
EFETVEEIACDTLMPRGYTYCRCTEYHLECVMTGDEDRFYVLTPIDIILAQKLDANDHVE
WLIKRNRFEEAMKYAENPSNARLLNTGKLQEVGIAYIYHLLEHKKFEDAARKCSGVLGLN
VQRWEDIIWQFIAKGVLHKILPYIPKSKPKLSPTIYEMVLNQFLIHDPEELYKIIQDWPP
NLYDSNVIMNAVSDRLAKQPNDINILKVKAKLFEDRGDSESALDIYLRLGDVEVFDLIAN
KNLHNSLLDNLEYLLQLGEEPLTKTVELLVEFRHDDVIPPQKVVSKLEGFRTEKRWEYFL
HRYLDLLFDRDPKAGSEYHERQVQLYADYNRKKLLPFLRACNDIPLKKALDVCTNRSLYE
AMVFLLDRMGNPKEALRLIVSKLHDVDQAILFVREKDDEELWDTLIQLSRDLPDFITGLL
QNAGTHIDPTKLIKEIPSQLKIANLGLSLVKLLNDYQLQVNLREGCKKILVKDSHDLMEK
LHILHNRATSFDMGATCFNCSREFSVDDATTLMMFFCGHMYHQNCVSHKNDMDICHLCYR
SSNKNLRQPLHP
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgacgaggtctctagctacgaggaagaagaaggctctaccagtggagaggaa
gcagaagatggcgaggaggaagaagaagatgatgatgaagacgaagagccgttattgaag
tacagcagatttgctaaagacgtcgtcaactctttaagccaaatgccatcaaacactact
gaaggagagcccaagaacgtcatagtttgtatggccgtgcatcctaaatttatagctctt
gggacttacgatgggactgtcaagttattggaccatactgggactgtgttagctgatcgt
gaatatcgtttacatatagctcaaattaatcatatctcagtagatcaagaaggagacttc
atggcttgctgctctaatgatggaaaagtgtcaatagttggtctgtttacagctaagtat
aataatagtgtacagtttgaaagagcagtgaaatctgttgctattcatcctcattttggc
aagtcaacaaatcgaatgtttgccataggaatcgacaaagtgttactggtagaggagaga
cgttggccattgattggttataagaatacagagatacactccggctatggcattgttgaa
gtaattaaatggagagacaactacatggcttgggctaatgaaaaaacagtttttgcttac
aacgtggcaaccaagtctttaataacttgcatcagatttgatgaagaaagtcccatatct
ctcccatgcagtctctgttgggttaagaatggtttgcttcttgttggacgtggacacatc
gttaaagttgctgaagtgagagaagtgacagagaatgtagttttaatggacggatacgct
agtggtgtggaggcacagccagccaagaagaaagagctaatgaaaataagtgctcagaat
atgtttcctaatttccttgtctgtggtgttgtccccatcatgaatagagacaagagctgg
aacatggttgtcttgggatatgacgcccacattaatcaagaagaagccatacataaaggg
actgtaccaccccctcacttgattgtaagaccacctgcaatgtatctaccggacagtgaa
gagtttgaaacagttgaagaaatagcatgtgacacattaatgccacgtggatacacttac
tgtcgctgtacagagtatcatcttgagtgtgtaatgactggcgatgaggatcggttctat
gtactgactccaattgatataatattagcacagaaacttgatgcaaacgatcacgttgaa
tggttgatcaagagaaatagatttgaggaagcaatgaaatatgccgaaaaccctagcaat
gccagattgttgaatacaggaaaattgcaagaagttggaatagcttatatttatcatttg
ttggaacataaaaagtttgaagatgcagcaagaaagtgcagtggtgttttgggattaaat
gtgcagagatgggaagatatcatttggcagtttatagcaaaaggagtccttcataaaatc
ttgccttacattccaaaatcaaagcccaaattaagtccaactatctacgaaatggtttta
aatcaattcctgatccatgaccctgaggaattatataaaataatacaagactggccacca
aatttgtatgactctaatgtcattatgaatgcagtctctgatcgacttgctaaacaaccc
aatgatattaacatattgaaagtgaaagctaaactttttgaagatagaggagattctgaa
agtgctctggatatatacctaagattgggagatgtagaagtttttgatttgattgcaaat
aaaaaccttcacaactctctcctcgataatttggagtatcttttgcaactgggagaggag
cctctcacaaagactgtcgaattattagtagagtttcgacatgatgatgtcataccgcct
cagaaagttgttagcaagttggaaggattcaggacagagaaacgatgggaatattttttg
cacagatatcttgatttattatttgatcgtgatcctaaagctgggagtgaatatcacgaa
agacaggtccagctctacgccgactacaatagaaagaaattattaccatttttgagagcg
tgcaatgacataccattaaaaaaagcattagatgtatgcactaacaggtcattgtatgaa
gcaatggtttttctattagacaggatgggtaaccctaaagaagctttgagactgatcgtc
agtaaattacacgacgtggatcaagcaatattatttgtaagagagaaagatgacgaagaa
ttgtgggacactctcatccagctgtcaagagacctgcctgattttataactggtttactt
caaaacgctggtacacatattgatccaactaaattaattaaagaaatacctagccagtta
aaaatagctaaccttggtctatcattggtaaaactgttgaatgactaccagctccaagtc
aacctgagggaaggctgcaagaagatactagtcaaagacagtcatgatttaatggaaaaa
ctacacattctccataatagagcaacctcctttgacatgggggctacttgttttaactgt
tctcgtgaattttctgttgatgatgcaacgacattaatgatgtttttctgtggacatatg
tatcatcaaaattgcgtgtctcataaaaatgacatggatatttgtcacttgtgttatcgc
tcttccaataaaaacttgagacaaccgttgcatccataa

DBGET integrated database retrieval system