KEGG   Amphimedon queenslandica (sponge): 100639130Help
Entry
100639130         CDS       T02284                                 

Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00071  Fatty acid degradation
aqu00592  alpha-Linolenic acid metabolism
aqu01040  Biosynthesis of unsaturated fatty acids
aqu01100  Metabolic pathways
aqu01212  Fatty acid metabolism
aqu04146  Peroxisome
Module
aqu_M00087  beta-Oxidation
aqu_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100639130
   00592 alpha-Linolenic acid metabolism
    100639130
   01040 Biosynthesis of unsaturated fatty acids
    100639130
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100639130
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     100639130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_1 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 100639130
NCBI-ProteinID: XP_003391494
Position
Unknown
AA seq 513 aa AA seqDB search
LETTATYDPLTEEFVLNSPTLTSMKWWPGTLGHTATHAVVVARLITKGKDEGIHLFIVQL
RSLEDHRPLPGIKVGDIGPKFGYFGMDNGFLHMTNVRIPRDQMLMKYAQVSRDGTYSKPP
TDKITYGTMVFVRAGIVVQSASILARAVTIAIRYSVVRRQTQNRPGEPETQVLDYQTQQF
KLFPLLASAYAMKFASQYMLKLYVGITGEIAEGNLESLPELHATSAGLKALCSEISSNGV
ELCRLCCGGHGYSAASGLPQLYVDYSPAQTYEGENTVMLLQTARYLLKISRQKVPQAQLP
NNVAYLGVDYPKYKESPVLTPKQFNDPHILLEAYRQRVIRLVAVALRRYMNGIDSGLDAV
AAWNNSSVDWTVAARAHCHYLVLKAFQSSIDTAEMCETNLSIMRVLCCLFGLFGIMQYSG
EFCLDGYMNSDQIEMAKNQLYSLLKEVRYEAVPLVDAFDIHDDILNSCLGRYDGDVYRHL
YQWALRAPRNKKEVHDTYEKYLRPLLKKTKSKL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
cttgaaactacagcaacttatgaccccttgactgaggaatttgttctcaattccccaact
cttacttcaatgaaatggtggcctggaacacttggtcatactgccacacatgctgtggtt
gttgcaagactaataaccaaaggaaaagatgaaggaattcatttgttcattgtgcagcta
cgtagccttgaggaccatagaccactaccaggaataaaggtcggagacattggaccaaag
tttgggtactttggcatggacaacggtttcctccacatgacgaatgtgaggataccaaga
gatcaaatgctaatgaaatatgctcaggtatcacgagatggtacttactcaaagcctcca
actgataagatcacgtatggtactatggtttttgtaagagctggtattgtcgtccagtcg
gctagcatcctggccagggctgttactatagcaatcagatacagtgtagtcagaagacag
acacagaacagacctggtgagccagagacacaagtactggattatcaaactcagcagttc
aagctctttcctctattggcctctgcttatgctatgaagtttgctagtcagtacatgctc
aaactttatgttggaatcactggagaaattgccgaagggaatcttgaatctctaccagaa
cttcatgctaccagtgctggtttaaaagctctttgttctgaaatatcttctaatggtgtt
gagctctgcaggttgtgttgtggtggtcatggatattcagccgctagtggtctacctcag
ctttatgttgattattctccagcacagacatatgaaggagagaacacagtcatgttactc
caaacagcaaggtatcttttgaagatatccagacagaaagttcctcaggctcagttgcca
aacaatgtggcgtatcttggagtcgattatccaaagtataaggagagcccggttttgact
ccaaaacaatttaatgatccacacattttactggaagcatatcgccagagagtgattagg
ttagttgctgtggcattaaggaggtacatgaatggcattgactctggattggatgctgtt
gctgcctggaataactcttcagtggattggacagtagcagcaagagctcactgtcattat
cttgttttaaaagcattccagtccagtatagatacagctgaaatgtgtgaaactaattta
agtataatgagagttttgtgctgcttgtttggactctttggtataatgcagtacagtgga
gaattctgcctggatgggtatatgaatagtgatcagatcgaaatggccaagaaccagctt
tattccctgctaaaggaagtgagatatgaagcagttccattggttgatgcatttgatatt
catgatgacatattaaactcgtgtcttggtcgttatgatggtgatgtatacagacacttg
tatcaatgggcactaagagcccctaggaacaagaaagaggttcatgatacttatgagaaa
tatttgaggccgcttttaaagaaaactaagtccaagctatga

DBGET integrated database retrieval system