KEGG   Amphimedon queenslandica (sponge): 100639293Help
Entry
100639293         CDS       T02284                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00520  Amino sugar and nucleotide sugar metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100639293
Enzymes [BR:aqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     100639293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 100639293
NCBI-ProteinID: XP_011407364
UniProt: A0A1X7TK68
Position
Unknown
AA seq 236 aa AA seqDB search
MYNPVKTIKSNTIGTINVLGLAKRVKARVLFASTSEIYGDPEEHPQKETYWGHVNTIGPR
ACYDESKRVAETLMYAYSKRDHIDVRVARIFNTYGPRMHMYDGRVVSNFIVQTLNGHPLT
VYAPGNQTRSFMYVSDLVSGLMKLMNSNYSLPCNLGNPEEHTILEFAQLVQDITGVKGKV
SMKKSQQDDPHKRKPDITVAKTQLGWEPKVSLRDGILKTTAYFRKELGLVDNEQEQ
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtataatccagtgaagacaataaagagcaacaccataggaaccattaatgtactaggt
ttggctaagagagtgaaggctagagtactgtttgcatcaacatcagaaatatacggagac
cctgaagagcatccccagaaggagacctattggggtcatgttaatacgattggtcccaga
gcttgttacgatgagagcaagagagtcgcagagaccctcatgtacgcctactccaagaga
gaccatattgatgtacgagtggccaggatattcaatacttatggccccaggatgcacatg
tatgatggtcgtgtagttagtaatttcatcgttcaaacattaaatggtcacccactaaca
gtctatgctccagggaaccaaacacgatcgttcatgtatgtgagtgatctcgttagtgga
ctaatgaaactgatgaacagtaattattcattgccctgtaacctgggtaatccagaggag
cacactatattggagtttgctcaactggttcaggatataactggagttaaaggtaaagtg
tcaatgaagaagagccaacaggatgatccacacaagaggaaacctgatatcactgttgct
aagacacaactgggatgggaaccaaaagtatcactaagagatggtattctaaagaccact
gcatacttcaggaaagagcttggactagtggacaatgaacaagaacaatag

DBGET integrated database retrieval system