KEGG   Amphimedon queenslandica (sponge): 100639301
Entry
100639301         CDS       T02284                                 

Definition
(RefSeq) cell division cycle-associated 7-like protein
  KO
K23408  cell division cycle-associated protein 7
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aqu03036]
    100639301
Chromosome and associated proteins [BR:aqu03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    100639301
SSDB
Motif
Pfam: zf-4CXXC_R1 Endonuclease_7
Other DBs
NCBI-GeneID: 100639301
NCBI-ProteinID: XP_003382727
UniProt: A0A1X7VWG1
Position
Unknown
AA seq 258 aa
MAEKKLSQYELNRLQKIKENQELLNQLFPEGTKLHSSPREATPTVGLIVNRKSSSCRKLK
YSARRYNTRQSRDYYEGPMTRSMRTRFGGEEGGEKAKSAEPSFLDDEYHYRVAPRKRRYV
QVQEEIEIELDDRPGLDVKYLKRVVDSNKSKIYDRINGTTCHQCRQKTIDQKTVCHNKYC
NGVRGQFCGPCLKNRYGEDIRECLVDKTWVCPPCRGKCNCSFCLPKKGCPPTGIMIHIAK
EAGYDSVQEYLEKSDYNY
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcggaaaagaagttgagccaatacgagctgaacaggctccaaaaaataaaagagaac
caagaactactcaaccaattatttcctgaaggaacaaagctgcactcttctcctcgggag
gcaacaccgactgttggtcttatagtcaataggaaatcaagctcgtgtagaaaattgaaa
tattcagctcgtcgatacaacacgagacagagcagggactattatgaaggccccatgaca
agaagcatgagaacaaggtttggaggagaagaaggtggagaaaaggccaaaagtgccgaa
ccgtcattcttagatgatgagtatcactatagagtggctccaagaaagcgtcgatacgtt
caagtgcaagaagagattgaaattgagttggatgacagacctggccttgacgtcaagtat
ctgaaaagagttgttgattccaacaagagtaaaatatatgaccgcatcaatggtactaca
tgtcatcagtgcaggcaaaaaaccatagaccagaagacagtatgtcacaataaatactgc
aatggtgttagaggacagttttgtggtccttgcctgaagaacaggtatggagaggatatc
agggagtgtctggttgacaagacgtgggtttgtcctccttgtcgaggaaagtgtaactgt
agcttctgcctaccgaagaaaggctgccctccaactggaatcatgatacacatagccaag
gaagccggctacgacagcgttcaagaatatcttgaaaaatctgattataattactga

DBGET integrated database retrieval system