KEGG   Amphimedon queenslandica (sponge): 100639379
Entry
100639379         CDS       T02284                                 

Definition
(RefSeq) zinc finger BED domain-containing protein 1-like
  KO
K24637  zinc finger BED domain-containing protein 1 (E3 SUMO-protein ligase ZBED1) [EC:2.3.2.-]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aqu03000]
    100639379
   04121 Ubiquitin system [BR:aqu04121]
    100639379
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100639379
Transcription factors [BR:aqu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BED
    100639379
Ubiquitin system [BR:aqu04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100639379
SSDB
Motif
Pfam: Dimer_Tnp_hAT zf-BED DUF659 DUF4413 DBD_Tnp_Hermes pRN1_helical
Other DBs
NCBI-GeneID: 100639379
NCBI-ProteinID: XP_003390586
UniProt: A0A1X7TGY6
Position
Unknown
AA seq 605 aa
MASPSSTSKRSRSSVWTYFNKVDDDKNAACLICKSKLTYCKNTSNLLKHLQTKHQKEYQE
CLEERKANENQKKAKRSESSTPVQTIPDMFLQSHPYSSDSMKKKKIDDAVIEFICKDMQP
TSVVEDAGFKKLVTVLDNRYQVPSRRTITREILPKKYESTKAKIEEEMNTATSVALTTDI
WTSCQTKSYCCVTAHLINGDWELKSYLLETFHFCLDHTAANISIELQRVVESWNIQDKIV
CVVTDYAANMVAAISSTRWRHLPCFAHSLNLVVQNSIKSDPELFAIQTKCKNVVSHFHRS
VKSTEKLGEIQRQLSLPEHKLIQDVSTHWNSTYIMLERFYEQFEAITMTLCLVNQNDLCL
KADKKDTISRALQLLKPFLEATENISGQAYVSISMIVPLTKILQQHCSSLYRANPSSVLA
GSLNSELNNRFTSIETHYVTAVSTLLDPRFKKISFADKTALSHTMNRITQELQTVVPEPS
INSTDQDSRSPDMEEASTDSIWNSFDQKAKESQIHRTSTVEATIEVRRYFEEAVISRNKD
PLEWWKENSCRFPLLKVLARRYLCIPGSSVPSERLFSQAGVLVSERRNRISPKNVDIILF
LNQNL
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggcttctccttcttctacttcaaaacgatccagaagttcagtgtggacatatttcaat
aaagtagatgatgacaagaatgctgcttgcctaatctgcaaaagcaagttaacatattgt
aagaatacaagcaacttactaaaacatctccagacaaaacatcaaaaagagtaccaggaa
tgtcttgaggaaaggaaagcaaatgagaatcaaaagaaggccaaacgttcagaatcatcc
acgccagttcaaacaatacctgatatgttccttcagagccatccatattccagtgactct
atgaaaaagaagaaaatagatgatgcagttattgaatttatttgcaaagatatgcaacct
acctctgtagttgaagatgctggttttaagaaactggtcactgtgcttgacaatcgttat
caagttcctagtcggcgtacaataacaagagaaattctaccaaagaagtatgaaagtacg
aaagcaaagattgaggaagagatgaacactgctacttctgttgctcttaccacagacata
tggacatcatgccaaacaaaatcctactgttgtgttacagctcatctaataaatggagac
tgggagctgaagtcataccttttggaaacctttcatttctgcttggatcacacagcagcc
aatatttcgatagagttacaacgagttgttgaaagctggaacatacaagataaaatagta
tgtgtggtcactgactatgctgctaacatggtggctgctatttcatcaactcgttggcgt
catctaccatgctttgcacactctctaaatcttgtagtccagaactcaatcaagagtgat
cctgagctttttgcaatacaaacaaagtgtaaaaatgttgtttcacactttcatcgcagt
gttaaatcaacagagaagctaggagagatccaacgccaactttcactcccagagcacaag
ttgatacaagatgtttccactcattggaattcaacttacatcatgcttgaacgtttttac
gagcaatttgaagcaataacaatgactctctgtttggtgaatcaaaatgatctttgcttg
aaagctgacaagaaggacacaatttctagagcactgcaactattaaagccatttttagaa
gccacagagaacatatcagggcaagcatatgtttctatttcaatgatagttcctttaacg
aaaattcttcaacagcactgtagctcactttatagagccaatccttcctcagtacttgct
ggatccctgaactcagaactgaataacaggtttacgtctattgagacccactatgtcaca
gcagttagcactctacttgatccgcgttttaaaaaaatttccttcgctgacaagacagcc
cttagccacacaatgaacagaataacacaagagttacaaacggttgttcccgaaccatca
atcaactcaactgatcaggattctaggtcacctgacatggaagaggcctcaactgacagt
atttggaactcatttgaccaaaaggctaaggagtcacaaattcatcgaacttctactgtt
gaggcaactatagaagtcaggagatacttcgaggaagccgtcattagtagaaataaagat
cctcttgaatggtggaaagaaaacagctgtcgtttcccattgttaaaagtgctagcaaga
cgttatttatgcattccaggttcatctgtcccttctgaaagacttttttcccaggcagga
gtcctagtttctgaaagaagaaatcgtatctcaccaaagaatgtggacatcattttgttt
ctcaaccagaacttatag

DBGET integrated database retrieval system