KEGG   Amphimedon queenslandica (sponge): 100639827Help
Entry
100639827         CDS       T02284                                 

Definition
(RefSeq) glutathione peroxidase 7-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00480  Glutathione metabolism
aqu00590  Arachidonic acid metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100639827
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100639827
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100639827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 100639827
NCBI-ProteinID: XP_003388439
UniProt: A0A1X7UC27
Position
Unknown
AA seq 184 aa AA seqDB search
MEQVFFLSLFCLICGALASSGTETFYSLSAKDITGKMIGFERYSGKIVLVVNVASECGYT
DYNYIQLNQLQLRYGEESLAILAFPCNQFGAQEPAKDSEINSMIRYKYKPQFPLFSKVNV
TGESQSEVYRFLINSTNGLEPKWNFCKYLLDRDGLVVQFFDQGKTFDKIYDSIDGLLYRK
RREL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggaacaagtctttttcctttctctcttttgcctaatctgtggagctcttgcttcctct
gggactgagactttctactctctttctgctaaggacattactgggaaaatgattggcttt
gagagatacagtggaaaaattgttcttgttgttaatgttgccagcgagtgcggctataca
gactacaattatatccaactcaaccagctccaattaagatacggagaagagtccttggct
attttagcttttccttgcaatcagttcggagctcaagaaccagcgaaagactccgaaatc
aattcaatgatacgctacaagtacaagcctcagtttcctctgttttcgaaagttaacgtc
actggagagagtcaatctgaagtttaccggtttctaattaattccacaaatggtttggag
ccgaaatggaatttttgcaagtatctgctcgatcgcgacggacttgtagtccagttcttt
gatcaagggaagacatttgataagatttacgactcgattgacggacttttgtatcgaaaa
agacgggaactttga

DBGET integrated database retrieval system