KEGG   Amphimedon queenslandica (sponge): 100639963Help
Entry
100639963         CDS       T02284                                 

Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase-like
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00010  Glycolysis / Gluconeogenesis
aqu00053  Ascorbate and aldarate metabolism
aqu00071  Fatty acid degradation
aqu00260  Glycine, serine and threonine metabolism
aqu00280  Valine, leucine and isoleucine degradation
aqu00310  Lysine degradation
aqu00330  Arginine and proline metabolism
aqu00340  Histidine metabolism
aqu00380  Tryptophan metabolism
aqu00410  beta-Alanine metabolism
aqu00561  Glycerolipid metabolism
aqu00620  Pyruvate metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100639963
   00053 Ascorbate and aldarate metabolism
    100639963
   00620 Pyruvate metabolism
    100639963
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100639963
   00561 Glycerolipid metabolism
    100639963
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100639963
   00280 Valine, leucine and isoleucine degradation
    100639963
   00310 Lysine degradation
    100639963
   00330 Arginine and proline metabolism
    100639963
   00340 Histidine metabolism
    100639963
   00380 Tryptophan metabolism
    100639963
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100639963
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100639963
    1.2.1.8  betaine-aldehyde dehydrogenase
     100639963
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100639963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100639963
NCBI-ProteinID: XP_019860319
UniProt: A0A1X7TCB6
Position
Unknown
AA seq 465 aa AA seqDB search
MFSRLLSVSSLVPRYGWTRQYSGYLINQPEYQWLKELGLQEKNPGVYDGTKWCGSGPVID
SISPINGRPIAAIQEGNKDDYNNAVINSMNAWKIWREVPGPLRGNIVREMNEEFRKNKNS
LGKLIALEVGKLQSEGFDEVDDYIKCCDLAIGLSRMIGGHISPSERPGHMLMEQWNPYGL
VGIITAFNYPASVFGWNQSLSLVCGNCTVWKGSPSTPLTQIAVSKIVERVLTSNSIPAGV
CTSVCGGADIGESMCKDKRINVLSFTGSTQVGRKVGVMVQERFGKSILELGGNNAILVDE
TADVDILMNELYNGLFVANGQCCTSTRRLIVHDSLYDEVLRRLLKMYSKTKVGDPFDDEV
RLGPVHTNGSVEMFEKTINLIKEQGGTIECGGNVINREGYYVQPTIVTGLQHDNELVMRE
TFVPILYILKSTSIDESIKWNNEVEQGLASSLFTQSIERMSRWMG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaagacttttgtcagtttcctctctcgttcctcgctatggatggaccagacag
tactcagggtacctcattaatcagcccgaataccagtggcttaaagaactaggattacaa
gagaaaaatccgggagtatacgatggaactaagtggtgtgggagtggtccagtgattgat
tcaatatctccaattaatggccgacccattgcagccatacaagagggtaataaagatgat
tacaataatgctgtcattaattcaatgaacgcctggaagatatggagggaagtaccgggt
cccttgaggggtaatattgtgagagaaatgaacgaggaatttaggaaaaataaaaattca
ttaggaaaattaattgctcttgaagttggtaagttgcagtccgaaggttttgacgaagtt
gatgattacattaaatgttgtgaccttgcgatcggactctctcgtatgattggaggacac
atctccccatcagagagaccaggtcatatgttaatggaacaatggaacccatacgggcta
gtcggaatcatcacggcttttaattatccagcgtctgtctttggttggaaccaatccctt
agcctagtgtgtggtaactgtactgtatggaagggatcacccagtactccgttaactcag
atagcagtcagtaagatagtagagagagtgttgacaagtaactctataccagctggagtc
tgtactagtgtgtgtggtggggctgatatcggagagtcaatgtgtaaagataaaagaatt
aatgtactatcatttactggaagtactcaagttggccgtaaagtaggtgtgatggtccag
gaaaggttcggtaagagtatactagaactgggaggtaacaacgccatactggttgatgaa
actgctgatgtggatatactaatgaatgaactatacaatggactgtttgtagctaatgga
cagtgttgtacttctacaaggagactgatagtacatgatagtctttatgatgaagtgttg
agaaggttattaaagatgtacagcaaaacaaaagtgggagatccttttgatgatgaggtt
agactggggcctgttcatacaaatggaagtgtagaaatgtttgaaaaaacaattaattta
ataaaagaacaaggaggaactattgagtgtggtggaaatgtaataaacagagaaggttat
tatgtccagcctacaatagtcactggcctacagcacgacaatgaattggtaatgagggaa
acctttgtaccgatactgtacatattgaaatcaacttcaattgatgagtccattaaatgg
aacaatgaagtggagcaagggctagcatcatcactattcacacagtccattgaaaggatg
tcaagatggatggggtaa

DBGET integrated database retrieval system