KEGG   Amphimedon queenslandica (sponge): 100640192Help
Entry
100640192         CDS       T02284                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00562  Inositol phosphate metabolism
aqu04068  FoxO signaling pathway
aqu04070  Phosphatidylinositol signaling system
aqu04140  Autophagy - animal
aqu04150  mTOR signaling pathway
aqu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100640192
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100640192
   04070 Phosphatidylinositol signaling system
    100640192
   04150 mTOR signaling pathway
    100640192
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100640192
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100640192
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100640192
Membrane trafficking [BR:aqu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100640192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_C2 PI3K_rbd C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 100640192
NCBI-ProteinID: XP_019863071
UniProt: A0A1X7VMF2
Position
Unknown
AA seq 1059 aa AA seqDB search
MAARRNLPPVPVPQGLPPVPQSPHPALIQDEKINMDILMPTGMLITLACYKQASLSDIKA
AVWQEARNQPLFEMIKDQSFYSFFGITADGNKEELVNESHSLADIDLFVPLLKLKERAGD
MKEKKLNAEIGALIGRKLADFDVMEAEVQDCRRHWLFVCEEVLNLRQMNDETLRRYNFSA
LTVGPDEPNLSQQALNGELEVSFLNARGQMYPLKLPFSYDRSASDLINLSFSQPEVRKSF
KRYQPKDFSLKVQGSEEYLLENVPLQQYKYVLHCIARHIQPKFCLIPYEGILTVEKDVFI
RPIHALQSGKDAKWQSDCGPFNLSRGTIGKDQMSYISTWNVRQTYKIKVVGAANINVSDT
MKVYVRAGLGHGDQTLCPTTSTSKGASPEKPEWNELLEFDVPILEMPRSAKLCFIIYQQK
QPGRKSKEDAPLAWVNLNAFDYDGVLQAGRFTLNAWPIEDDHAIQDQLNYIGSTVPNAHL
SKSIQLTIEIPHFSSVPILFPSASEIQAFAVEMAQGSVSSARFNNQEIDELRRIIEQDPL
DELDESDKEILWKMRNVCCDRHPEALPKLLQSVTWSNRSDVAQVYLLLERWSRLNPEQAM
ELLHFQYADLAVRQYAVTCLESLSDNKLLMYLLQLVQALKFEPYLDCPLAEFLLKKALSN
KSIGHYLFWYLRAEMHLPIVSVRYGLILEAYCRGCGRYRESLAKQVDALGKWKQVTGELQ
KVQKAKKSKAVDERDFLRTPHLLKAMEDLRSPLNPALMLKNLLPDKCKVMDSKMRPLWLS
FVNMDPLGGTVLQIFKNGDDLRQDMLTLQVMNIMDNVWREAGLDLRMNPYACLSMGDQVG
LIEVVLDSTTIAKIQKQQSGARGAFDKKLLYSWLKSKNKSQAELNKAVDNFTLSCAGSCV
ATYVLGIGDRHSDNIMLKSNGQLVHIDFGHFLGNFKSKFGVKRERVPFVLTDDFIHIITR
EEGKTSFEFVKFKNLCEKAFMLLRQKGDLFITLFTMMLSTGIPELRTIDDIRYISNALCL
SKNDDQAKEDFRKKLAEAVKHSWSVSINWYFHNVARTGN
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcggaggaaccttccaccagtaccagtcccccagggcctacctcctgtccct
cagtctcctcacccagctcttattcaagacgaaaagatcaacatggacatattgatgcct
actggcatgcttataaccctcgcctgctacaaacaagcatctctatcggatataaaggct
gccgtgtggcaagaggcccgtaaccagccgttatttgaaatgatcaaggaccagagcttc
tactccttctttggtatcactgctgatggtaacaaggaagaactggttaatgagtcacac
agtttggctgacattgatctgtttgttccgcttctgaagctgaaagagagagcaggagac
atgaaagagaagaaactcaatgccgagatcggggctctcatcggtcgtaaactggcagat
ttcgacgtgatggaagccgaggtccaagactgtcggcgtcactggctgttcgtgtgtgag
gaggttcttaatttgcgtcaaatgaatgatgagactttgagaaggtataacttctctgct
cttactgtaggaccagatgagccaaacctcagccagcaagcactgaatggtgagcttgaa
gtcagtttccttaatgcccgtggtcagatgtacccgctgaagttacccttttcctacgac
aggtctgcctctgacctcattaatctctccttctctcagcctgaggttcggaaatccttc
aagcgctaccaaccgaaggactttagtcttaaagtccaaggatccgaagaatatctattg
gaaaatgtaccactacaacaatacaagtatgttcttcactgcattgcacgtcacattcag
ccaaaattctgcctaatcccgtatgaaggaatactaacagttgaaaaggacgtatttatt
cgtcctattcatgcacttcaatctggaaaggatgcaaagtggcagtcggactgtggccct
tttaatttgtctcgtgggacaatcgggaaagatcaaatgtcttatatatcaacttggaac
gtgaggcagacctataaaattaaagttgttggagctgctaatatcaacgtatctgatact
atgaaagtttatgtgagggctggtcttggtcacggcgatcaaactctatgtcctaccact
tcaacttcaaagggagcatcccccgagaaaccagagtggaacgagctccttgagtttgat
gtgcctatacttgaaatgcctcggagcgccaaactctgtttcataatatatcagcagaaa
cagccaggacgaaagagcaaagaagatgctcccttggcttgggtgaacttgaatgcgttt
gattatgatggtgtccttcaggctggccgctttactctcaatgcgtggcccatcgaagat
gatcatgccattcaagatcagttaaactatattgggtctacagtacctaatgcccacctt
tccaaatccattcagttgacaattgagatacctcacttcagctcagttcctatattgttc
ccttcggctagtgagatacaagcctttgctgttgaaatggcccaaggctcagtttcttca
gctcgttttaataaccaggagatcgatgagcttcgtcgaatcatagaacaagatcctctt
gacgaattggatgaatctgacaaagaaattctatggaaaatgaggaacgtgtgctgtgac
agacaccctgaagctctgcctaagttattgcagtcagtcacctggagcaatcggagtgat
gtagcacaggtatatttgttgctggagaggtggtctcgtctcaacccagagcaggctatg
gagctccttcatttccagtatgctgatttagcagtgagacagtatgctgtaacctgcttg
gaatcattgagtgataataagctactcatgtatttgctccagctggttcaagctcttaaa
tttgagccgtatcttgactgccccctggcagagtttctcctgaagaaagctcttagcaat
aaatcaattggacactatcttttctggtatctcagagctgaaatgcatctacctattgtg
tcagtacgttatggtctcattcttgaggcttattgtagggggtgtggccgctacagagag
tcattagccaagcaggttgatgctcttggtaagtggaagcaggtgactggtgagctccag
aaggtgcagaaagcgaaaaagtctaaggctgtggacgagagagatttcttgaggactcct
catcttctgaaggcaatggaagaccttcggtctccgctaaatccagccttgatgcttaaa
aacctccttccagataaatgtaaagtgatggacagcaagatgaggcccctttggctatca
ttcgtcaacatggatccactcggcggtactgtactacagatattcaagaacggagatgat
ctaaggcaagacatgctgaccctacaagttatgaacattatggacaacgtctggcgtgag
gccggcctagatttaagaatgaatccttatgcttgtttgtcgatgggtgaccaggttggt
ctgattgaggtggtgttggactccacaactatagctaagatacagaagcagcagagtgga
gcaagaggagcctttgataaaaagttgctgtactcctggttgaagagtaagaataaatct
caagcagaattaaataaagcagttgataacttcacattgtcatgtgctggtagctgcgta
gccacttatgtacttggtataggggataggcactcagacaatataatgctcaaatctaat
ggacaattggttcatattgattttggtcacttccttggtaactttaagagcaagtttggc
gtgaaacgtgagagagtgccctttgtccttactgacgattttattcacatcattaccaga
gaagaagggaagacatcatttgagtttgtcaagtttaagaacctttgcgagaaggctttt
atgctcttacgtcagaaaggagatctcttcatcacactcttcactatgatgctctccact
ggtattcctgaacttaggacgatcgatgacattcgctacatcagcaatgctctttgtctt
tctaaaaatgatgaccaggcaaaggaggatttccgtaagaagttggcagaggctgtcaag
cattcttggagtgtcagtattaactggtatttccataatgtggcacgtactgggaattaa

DBGET integrated database retrieval system