KEGG   Amphimedon queenslandica (sponge): 100640805Help
Entry
100640805         CDS       T02284                                 

Definition
(RefSeq) endoplasmic reticulum resident protein 44-like isoform X1
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aqu04131]
    100640805
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aqu04147]
    100640805
Membrane trafficking [BR:aqu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100640805
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100640805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Calsequestrin Thioredoxin_7 Thioredoxin_2 Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 100640805
NCBI-ProteinID: XP_019855521
Position
Unknown
AA seq 413 aa AA seqDB search
MAVVSHSLGLIFILFLEFLACNGDAEFLSRSNMEQFKAGKKLMLINFYADWCRYSAALKP
VYDKAADQVAAETNEAVLVKVDCERDRIFCMQDFRITKYPTIKIIRNGELIRKEYRGQRT
VEALVSFVKKQIESPVHFVSNYAAALEKVEGNTKAAIGFFATNESIEYQNFNKIAFSLKD
ECRFFAIISSDTSAPQLTFREQSGSTDQQFNGDMTSHQAVQSWLSEHCIPLVREITFQNG
EELTEEGLPFFILFYHPDNPDIKAVFKRRVEEELLRHKGSVNFVTADGIKFAHPLSHLGK
SKKDLPVLAIDSFRHMYIFPNFNDIHVPGALNQFVEDLHSGKLHREFHHGPDVSFDSILR
VLHQNSTFQYQPRQPPKEEQKRDSGDTQQPPESTFKKLKPANSRYSFVDHDEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgtttcccactctctgggtttgatctttatactttttttagaattccttgct
tgtaatggtgatgccgagtttcttagtaggagtaatatggagcaatttaaagctggcaag
aagttaatgttgataaatttttatgctgattggtgtcgatatagtgctgctctcaagcct
gtgtatgataaggcagctgatcaagtggcagcagaaactaatgaagctgtgctggtcaaa
gttgattgcgagagagacagaatattttgtatgcaagactttcgtattaccaaataccca
actattaagatcatacgaaatggtgaattgatcaggaaagaatataggggccagagaact
gttgaagcattagtttcatttgtcaagaaacagattgaaagtcctgtccatttcgtttct
aattatgcagcagctttggaaaaggtagaaggaaatacaaaggctgctattggtttcttt
gccacaaatgaatcaattgagtatcaaaattttaataagatagcatttagtttgaaagat
gaatgcaggttctttgctattattagcagtgacacaagtgctcctcaacttacatttcga
gagcagtctgggtcaactgaccagcaatttaatggcgatatgacgtcccatcaggctgtt
cagagttggttatctgaacactgtattccacttgttagggaaatcacattccaaaatgga
gaagaactaactgaagaaggacttccttttttcattttgttctatcatcctgataaccct
gacattaaagctgtgtttaaaaggagagtagaggaagaattactgagacacaaaggatct
gttaattttgttactgctgatggtattaagtttgcacatccattgagtcatcttgggaaa
tctaaaaaagatcttcctgtactggccattgatagttttcgtcacatgtatatatttcca
aactttaatgatattcatgtacctggagcattaaatcagtttgttgaggacttacacagt
gggaaacttcatcgggaatttcaccacggaccagatgtaagttttgactcaatacttcgc
gttttacatcaaaattccacttttcaatatcagcctcgtcaacctccaaaagaggaacag
aagagagacagtggagatacccagcagccacctgaaagcacatttaaaaaacttaaacct
gcaaattcacgatactcttttgttgatcatgatgagttgtag

DBGET integrated database retrieval system