KEGG   Amphimedon queenslandica (sponge): 100641184Help
Entry
100641184         CDS       T02284                                 

Definition
(RefSeq) myotubularin-related protein 14-like
  KO
K18086  myotubularin-related protein 14 [EC:3.1.3.64 3.1.3.95]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00562  Inositol phosphate metabolism
aqu01100  Metabolic pathways
aqu04070  Phosphatidylinositol signaling system
aqu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100641184
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100641184
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100641184
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aqu01009]
    100641184
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100641184
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100641184
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100641184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related Y_phosphatase3 Y_phosphatase DSPc
Motif
Other DBs
NCBI-GeneID: 100641184
NCBI-ProteinID: XP_019857043
Position
Unknown
AA seq 454 aa AA seqDB search
MAKECSVVTCECLQELIGFFSSHGYKASSNERNFQIVEKMSLHLLARDYFIETVDNSDGN
LCPHYPTHLMIIAKREEDKDIVNNAGRLKEFFKVSKLARSLSRFPVPVILIGNKNICRSS
TLSTAMELYGRSGLDWVFSGKGKSGGSKEPEEVLQPKEKRLSEWALVDQAREFDSQLITA
LGVTLICDLMVEMRKTSYGLTLTSSEKADGRLWYSQFTIASLPYPGCEFFVHYRQNKDSI
GSVRYDWSMPSNDAVINVPSPLPESVGIDFTKYKSWNIIQHTQNYIKLLLHYLQYEEGGI
LIHCVAGWDRTPLYISLLRLSLWADGHIHKSLCPIEMLYLTLAYDWFMFGHKFEERLRKN
EEVLYFCFDFLQHITSDDFSFNLAPPTTTPITGTELKHNRGEQLLKIREIFLKVYDAAIP
LNPSHHEPARNEGRGGGIWGRVTSYFPGNGSTGM
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagaatgtagtgtggtgacatgtgagtgtttgcaggaattaataggattcttc
tcttctcatggctacaaagcaagcagcaatgaaagaaactttcagattgttgaaaaaatg
tcacttcatcttttagccagagattacttcattgaaacagtggataatagtgatggaaat
ctttgtcctcattacccaacccatctcatgataattgccaagagggaggaagataaggat
attgttaataatgccggtcgtctcaaagagttctttaaagtatcgaaactagctcggtct
ctctcaaggtttcctgtacctgtcatactaataggcaacaagaatatttgtcgctcctcc
acactctcgactgccatggagctttatggtagatcaggcctggactgggtattctctggt
aaaggaaagagtggtggaagcaaagaacccgaagaagtccttcaaccaaaagaaaagaga
ttatctgagtgggcgttggttgatcaagctagagagtttgactcacagttgatcactgcg
ttaggagtaacactgatatgtgatctgatggttgagatgagaaaaacatcatatggactg
actttaacatcatcagaaaaagctgatggcagattgtggtactcacaattcaccattgct
tcactaccatatccaggctgcgagttctttgtacattacaggcagaataaggactccatt
ggatcagttcgttatgactggagcatgccatcaaatgatgcagtcattaacgtacccagt
ccattgcctgaatctgttggaattgattttacaaaatacaaatcatggaatattattcaa
catactcagaactacattaagctcctattgcattacctccaatatgaggaaggtggcata
ttaatacactgtgttgcaggctgggacaggacccccctctatatatcattattaagatta
tcactgtgggcagatggccatatccataaatcactttgtcctatagagatgctgtatctt
acactagcttacgattggttcatgtttgggcacaagtttgaggagaggctccgtaaaaat
gaagaagtcttatatttctgttttgatttccttcaacacatcacttcagacgatttctct
tttaatttggctccacccacaactacacccattactggcaccgaattaaagcataacaga
ggagaacaattactaaaaattagggaaatatttttaaaagtgtacgacgctgctatacca
cttaatcctagtcatcatgaaccagcaaggaatgaaggcagaggtggcggaatatggggg
cgtgtcacaagttactttcctggaaatggaagtactggcatgtga

DBGET integrated database retrieval system