KEGG   Amphimedon queenslandica (sponge): 100641484Help
Entry
100641484         CDS       T02284                                 

Definition
(RefSeq) probable 1,4-beta-D-glucan cellobiohydrolase B
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00500  Starch and sucrose metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100641484
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     100641484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 100641484
NCBI-ProteinID: XP_003391584
Position
Unknown
AA seq 182 aa AA seqDB search
GCDFNPYRLGDHTFFGPGSNFTIDTTQVFTVVTQFVTNDNTDNGVLSEIRRQWIQNGKVI
MSRNITVGGKTFNSVTDDFCNTQKTAFGDSNDYEKRGGHKKLSEVLDQGMVLVMSLWDDH
AVNMLWLDSDYPLDKSPSAPGVARGTCPTSSGKPSDVESKYPDASVTYSNIKYGPIGSTM
PK
NT seq 551 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgactttaatccctatcgtttgggagaccacaccttctttggtcctggatcaa
actttaccatcgacacgactcaagtgttcacagtggtaacacaattcgttacaaatgaca
acacagataatggagtcctctcagagatacgcagacaatggatacaaaatggtaaagtta
taatgagcaggaacataactgttggcggtaagacttttaactcagtgacagacgatttct
gtaatacacagaaaactgcatttggcgatagcaatgactatgagaagagaggtggtcata
agaagctaagtgaagtgctggatcagggtatggtcctagtcatgagtctttgggacgatc
acgctgtcaacatgctctggcttgattccgattaccctctcgacaagtctccatcagcac
caggtgtagctagggggacctgccccactagttccggtaaaccttctgatgttgagagta
agtaccctgacgccagtgtgacttactctaacatcaagtatggacctattggatctacga
tgccaaagtga

DBGET integrated database retrieval system