KEGG   Amphimedon queenslandica (sponge): 100641617Help
Entry
100641617         CDS       T02284                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00480  Glutathione metabolism
aqu00980  Metabolism of xenobiotics by cytochrome P450
aqu00982  Drug metabolism - cytochrome P450
aqu00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100641617
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100641617
   00982 Drug metabolism - cytochrome P450
    100641617
   00983 Drug metabolism - other enzymes
    100641617
Enzymes [BR:aqu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100641617
Transporters [BR:aqu02000]
 Other Transporters
  Pores ion channels [TC:1]
   100641617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 Glutaredoxin GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 100641617
NCBI-ProteinID: XP_003382979
UniProt: A0A1X7VRS3
Position
Unknown
AA seq 252 aa AA seqDB search
MSLIRTRPEEKGADIPLRIYSNPICPYAQRARLIAAFKGVKHEIINVHLKEKPQWYLDDI
NPYGLVPTIEHNGHLIRESLVTFEYIDEVFGDSHSWPTDPYKKAQAKLLLSDFGDRFTPN
YYKYYRNAQDENTPKLLQKYFKSVEELIAQNGGPFIFGKNVSAIDLLIWPWFERLPALFT
HAPELKTLYSVDSVPLLIKWDAAMRETDAVKSTITPAERMTAFLANALSNGGKHDYSLLN
IDGLKIYTKETE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaataaggaccagaccagaagagaaaggagctgatattcctctaaggatatac
agcaatcctatttgcccctatgctcagagggccagactcattgccgcattcaaaggtgtt
aaacatgagatcattaacgttcatttgaaggagaagccccagtggtatcttgatgacatt
aatccttatggtcttgtaccaacgattgagcacaatggacatctcatccgtgaatcattg
gtgacctttgaatacattgatgaagtttttggtgatagtcactcgtggccaactgatcca
tataaaaaagcacaagctaaactattgctaagcgattttggtgatagattcactcctaat
tattataagtattatcgtaatgctcaagatgaaaacactcccaagctcctacagaagtac
ttcaaatcagttgaggagctaattgctcaaaatggtggcccgttcatatttggcaaaaac
gtctcagctattgatttgctgatatggccttggtttgagagactacctgctctatttaca
catgcaccagaattaaagacactgtacagtgtagatagtgtgccactactcattaagtgg
gatgctgcaatgagagagactgatgcagtcaagagtactatcactccagctgagcgtatg
actgcatttcttgctaatgccctcagcaatggagggaagcatgattacagtctattgaat
attgacggtttgaaaatatacaccaaagaaacagagtaa

DBGET integrated database retrieval system