KEGG   Amphimedon queenslandica (sponge): 100641912Help
Entry
100641912         CDS       T02284                                 

Definition
(RefSeq) dipeptidyl peptidase 3-like
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aqu01002]
    100641912
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     100641912
Peptidases [BR:aqu01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   100641912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49 DUF3873 2C_adapt
Motif
Other DBs
NCBI-GeneID: 100641912
NCBI-ProteinID: XP_003391512
Position
Unknown
AA seq 233 aa AA seqDB search
SFSLSLPLGFVAVVNKSMSSKFSQLVDSAQEFLPLLPWGVEFEKDKFLRPDFTSLDVVSF
ASSGIPAGINIPNYDEIRQNEGFKNVSLGNVLSAASQDKRVTFLTSEDQGIFTDLRGKAF
EVQVGLHELLGHGSGKLFGKDKNGVFNFEQDKVINPLTGDKIRSWYNPGETWDTQFSTIA
STYEECRAECVGIYLSTDRNILRIFGYEGAEAEDIMYVNWLSMLRAGLIALEF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
tcattctctctctctctccctctagggtttgttgctgttgttaataagtcgatgagttct
aaattctcacaactggtggactcagctcaagagttcctccctctcctcccttggggggtg
gagtttgaaaaggacaagttcctacgtccagactttacttcacttgatgttgtgtcgttt
gcctccagtggaataccagctggtatcaatatacctaactatgatgagataagacagaat
gaaggatttaagaatgtgtctttgggtaatgtattgtcagctgcctcacaggataagaga
gttacattccttacatcagaggatcagggtatttttactgatttgagaggtaaagcattt
gaagtgcaggttggattgcatgaactattaggacacggatcagggaaactgttcggtaag
gataagaatggagtctttaactttgaacaagataaagttattaatcctttgactggagat
aagataaggagctggtataatccaggagagacatgggatacacagtttagtacaatagca
tcaacttatgaagaatgtagagcagaatgtgttggtatatacctctccactgacaggaat
atattgcgtatatttggttatgaaggagctgaagctgaagacataatgtatgtgaattgg
ttgagcatgttgagggcaggacttatagcattagagttt

DBGET integrated database retrieval system