KEGG   Amphimedon queenslandica (sponge): 105311930Help
Entry
105311930         CDS       T02284                                 

Definition
(RefSeq) group XV phospholipase A2-like
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00564  Glycerophospholipid metabolism
aqu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105311930
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105311930
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     105311930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT PGAP1 DUF900 Abhydrolase_6 DUF676
Motif
Other DBs
NCBI-GeneID: 105311930
NCBI-ProteinID: XP_011402472
UniProt: A0A1X7VCD5
Position
Unknown
AA seq 414 aa AA seqDB search
MLCYIPTVSSFFLLILSLSSSVSTSFKPSDKPILIIPGIMGSQLWARLNRTSVNHPQCSK
TSDWYNIWLSLEQLVYPVEECASDNMMLQFNPNTSQFSPVDGVNITAPQFGNTSTIEFLD
PDLHSLEPAATFYAMVQYFVDNYGYTRGGTLRGAPYDWRYAAVGLESNGYYAKLKDLIEE
MYTLYNNPVTIIVHSMGGPVSLYFLTQVVTQDWKDTYIKQYITLSAVWAGSVKSNQAIIS
GDNEGIILDRPIWGRASQRTFQTTLWLLPPAGDVWGPNNTIVYAPTGEYSAYDYEKLMAD
VGYTNGPAMYRLIKDKTSEFPAPNVTTYCFYGLGKETPYKLHYDPDNFPNSPPKVTTIDG
DGTVPNISLTVCGRWSKQQVHPVTLRSFSPVEHVHMVKNKDVIDAVSKIIIADD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgttatattcctacagtttcttccttcttcctccttatcctctcactcagcagc
agtgtcagtacaagcttcaaaccatcagataaaccaatactgatcatccctggtattatg
ggtagtcagttgtgggcacgtctcaatcgtacatcagtgaatcatcctcaatgttcaaag
acttcagattggtacaatatttggctgagtcttgaacagctagtctatcctgttgaggaa
tgtgcttctgacaatatgatgttacagttcaacccaaataccagccagttctctcctgtt
gatggtgttaatatcactgcccctcagtttggtaacacctccactattgagttccttgac
cctgacctccattctcttgagccagctgctaccttctatgccatggtacaatactttgtt
gataactatgggtacactagaggagggactctgaggggagctccctatgactggagatat
gcagctgttggtttggagtccaatggttattatgctaagttgaaggatctaatagaagag
atgtacactttatacaataacccagtgacaataatagtccacagtatggggggacctgtc
tcactgtacttcctcacacaagtggtgactcaagactggaaagatacttacattaaacaa
tacattacactttctgctgtttgggctggatctgttaaaagcaaccaagccattatctcg
ggtgataatgaaggaataattcttgatcgacctatttggggacgagcgagtcagagaaca
ttccagactacattgtggctcctccctccagctggagacgtatggggacctaataataca
atagtgtatgcccccactggagaatatagtgcgtatgattatgagaaactgatggctgat
gttggttatactaatgggcctgctatgtatcggctaattaaagacaaaacttcagagttt
cctgccccaaacgtcaccacatactgcttctatggactgggtaaagagaccccctataag
ctccactatgatcctgataacttccctaattcacctcccaaagtaaccactattgatgga
gatggtacagtccctaatatcagcctcactgtctgtggcaggtggagcaagcagcaggtc
catcccgttaccctccgatccttcagtccagtggagcatgttcacatggtcaagaataaa
gatgtgatcgatgcagtttccaaaatcataattgctgatgactaa

DBGET integrated database retrieval system