KEGG   Amphimedon queenslandica (sponge): 109582726Help
Entry
109582726         CDS       T02284                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00010  Glycolysis / Gluconeogenesis
aqu00562  Inositol phosphate metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109582726
   00562 Inositol phosphate metabolism
    109582726
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     109582726
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     109582726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF3700
Motif
Other DBs
NCBI-GeneID: 109582726
NCBI-ProteinID: XP_019853181
Position
Unknown
AA seq 479 aa AA seqDB search
MLKIIVLLIIDLIIAILLVCFAPLPADEGEGKTAYRGVVGDGGVVDCDALLPSAASCSVS
FSSKTRYSFTPFINEDRMSLNGCTASKLYIIFRHGTRYPGKNHIRRFDSISEKLSNLSRS
SGVVNKLRGWINPFLIEEHSHLSSIGRKELYCLAKRFKQRYSGLFDEVYSPDSFSFASTH
KKRCVKSALSFAEGLFDGLDLSNGGESIGLQIDDRSLRFFDNCKEYTNKSKRNESLEAVL
NEFLFSDAISKALREIQQQIDESKRFWIINEHELLDMYQICAMETANFGHSNWCSLFSYS
SLQALEYYYDMKSYWTKGHGHTINWSISCHLINDIINSLSPSNPAKVTLRFAHAETLVPL
LSALSLYKDDLHLLPSNYHVMSSERKFRVSKMAPFSGNLAFVVYRCTKEMIFVSDDHEDF
VHVLSNEAPVTLDHSLCTGEGNGGNGGWCPLQSLPEIVRHVSDKLITYPCSLKDICIQA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaattattgtcctcttaattattgacctgataattgccatcctcctcgtctgc
tttgcccctttaccagcagacgaaggagaaggaaagacagcctacagaggtgtagtcggt
gatgggggagtggtcgattgtgatgctttacttccatcagctgcttcttgttcagtctcc
ttctcatcaaaaactcgctattcttttactccattcatcaatgaggatcgtatgtcattg
aatggttgtacagctagtaagttgtacattatttttcgtcatgggaccagatatcccgga
aagaaccacattagacgctttgacagtatttctgaaaaactttccaacttgagtcgatct
tcgggcgtagttaataaattaagaggctggataaacccatttctaattgaagagcactct
cacctctcctccattggaaggaaggagctctactgtcttgcaaaaagattcaaacaaagg
tattctggtctctttgatgaggtctattctcctgatagttttagttttgcaagcacacac
aagaagagatgtgttaaaagtgctctctcttttgctgaaggattgtttgatggacttgat
ttatcaaatggaggagaatccataggtctacaaattgatgacagatcattacgattcttt
gataactgcaaagagtatacaaacaaatcaaagagaaatgaatcactggaagctgttctc
aatgagttcttgtttagtgatgcaatttccaaagctttaagagaaattcagcagcaaatt
gatgaaagtaaaaggttttggattatcaatgagcacgagctactagacatgtatcagata
tgtgcgatggagactgctaactttgggcatagcaattggtgctcattattttcctactcc
tcccttcaagcgttagagtattactatgacatgaagtcatactggaccaaaggccatggt
catacaataaactggtctatttcgtgtcacttgataaacgatatcattaattcgctctct
ccctctaacccagcaaaagtgacattaaggtttgctcatgcagaaacacttgttcccctt
ctctctgccctctccctttataaagatgaccttcatctgttaccaagcaattaccatgtc
atgtcatctgaaagaaagtttagagtgagtaaaatggcccctttttccggcaacttggca
tttgtcgtttacagatgcactaaagaaatgatttttgtttcagatgatcatgaggacttt
gtacacgttctttctaatgaagcccccgttacattggatcattctctatgcacgggagaa
gggaatggagggaatggtggatggtgcccacttcaaagtttaccagaaattgttagacat
gtatcggacaaactcatcacttatccatgttctttaaaagatatatgtatacaggcttag

DBGET integrated database retrieval system