KEGG   Amphimedon queenslandica (sponge): 109590608Help
Entry
109590608         CDS       T02284                                 

Definition
(RefSeq) cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1-like
  KO
K14589  cap1 methyltransferase [EC:2.1.1.57]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aqu03019]
    109590608
Enzymes [BR:aqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.57  methyltransferase cap1
     109590608
Messenger RNA biogenesis [BR:aqu03019]
 Eukaryotic Type
  mRNA processing factors
   5' end processing
    Capping factors
     109590608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FtsJ WW
Motif
Other DBs
NCBI-GeneID: 109590608
NCBI-ProteinID: XP_019862066
Position
Unknown
AA seq 228 aa AA seqDB search
GASVEGQENIQEILMKQLVLCQYLCALSILRTGGHFVCKVFDMFTPFSVGLFYLLYRSFE
QVCIFKPVTSRPANSERYVVCRSLKEDKQSVNQYLFIINETIHELRQDEEEEKDILEVVP
NNLLQTEPFYTYITDSNDRVKPYYRVVDMISTFGDLRLRNCKGLGDVPTLDVSHDEWFIA
PIGVIFCKVLQEPWQLHFSQSSGRLYFFNYKTNKSSFEPPRESISPFL
NT seq 683 nt NT seq  +upstreamnt  +downstreamnt
ggtgcatcagttgaaggtcaggagaacattcaagaaatattaatgaagcaactggtactg
tgtcaatacttgtgtgctctatccatactgagaactggtggacattttgtctgtaaagtg
tttgacatgttcactccatttagtgttggcctgttctatcttctttaccgctcgtttgag
caagtctgcatattcaaaccagtaactagcagaccagccaattcagagaggtatgtggta
tgtagaagcctcaaggaagacaagcaatctgttaaccaatatttatttattataaatgaa
actattcatgaactaagacaagacgaagaagaagagaaagatattttagaggttgttcct
aataatttattacagaccgaaccattctacacttacattactgacagtaatgaccgggtt
aaaccatattatcgcgttgttgacatgatatcaacttttggagacttgagattacgtaac
tgcaaagggttaggggacgtacctacattagatgtctcacatgacgagtggtttatagca
cccattggagttatattctgtaaagtattacaagagccgtggcagcttcatttcagtcaa
tcaagtggtagactgtacttttttaattataaaacgaacaaaagctcattcgaaccaccc
agagaatcaatctcaccattcct

DBGET integrated database retrieval system