KEGG   Amphimedon queenslandica (sponge): 109592980Help
Entry
109592980         CDS       T02284                                 

Definition
(RefSeq) 39S ribosomal protein L22, mitochondrial-like
  KO
K02890  large subunit ribosomal protein L22
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    109592980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aqu03011]
    109592980
Ribosome [BR:aqu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    109592980
  Bacteria
    109592980
  Archaea
    109592980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 109592980
NCBI-ProteinID: XP_019863821
Position
Unknown
AA seq 96 aa AA seqDB search
MQTIKETQRNAIQIHKANPDNLYVSASYVGKGTYLKRIRYHGKGQSGKMYKYYSHYFLKL
REGPPPVKKKKSKEAQGCYATRRLIQRGPITIPNCL
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaataaaagagacccagaggaatgctatccagatacacaaagccaatccggac
aacctctatgtgtctgcctcttatgttggcaaaggaacttacctcaagcgtatccgatac
cacgggaagggtcagtcagggaaaatgtacaagtattattctcattatttcctgaagcta
cgggagggacctccacctgttaagaagaagaagagtaaagaggcccagggttgctatgct
acaaggagacttatacagagaggacccattactatacctaactgcctttga

DBGET integrated database retrieval system