KEGG   Amphimedon queenslandica (sponge): 109593762
Entry
109593762         CDS       T02284                                 

Definition
(RefSeq) uncharacterized protein LOC109593762
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aqu03036]
    109593762
Chromosome and associated proteins [BR:aqu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109593762
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3 DUF4207 PRIMA1
Other DBs
NCBI-GeneID: 109593762
NCBI-ProteinID: XP_019864380
Position
Unknown
AA seq 628 aa
MEHEILLACNIGDLPWLKASVEESKKEINEIYNNEGLTPLHLAAYTRNIPILKYLISKEL
DINSSTLYTANTPLHLVLLSSSCSVDNEGQAIRDCVQLLLSQGAQCNKRNSNGQTVLHLA
AKAGIVYIVRLLLDYEADFTLKDDRNQTPYDIACLYGNHECARLLRALHWAREKDIHAKR
KLQSERETQRQKVLCKTIQNQLRKQEAENAYDEWLCRNNFSLPPPPPPPPRSTSCLSCET
CSSITQLDSITQMDSLDTAVQSIHSSNEPKIAKIQISFNQAEHNTAPVGKPHKLYPYSNY
PPKQYRCHTKTEGHVESRNQRPFSSASNRRPSKRVVSHVRIKSAPTRIAIGTEQMQSKSK
SKMPHTRKIIHKATSVNGETYNDINGQTETMPSLIDTEKKEENVVVLTEEALKETTKDDA
NDEDGSSTSLDGLTFHDVGPENDLKSLASPVSNASGRGAASSINPVEFLRVLSELSSQRT
HSRSHGKYKPSTSIKYDRRFSLGSIPEGEMVTNYNQVEGSLVFDDDFLHNLMPFAFDSSH
FQGTEEPPSDHESPPHTPIERSAPSVKLAWDNSTPRTPDKSRVVSPANSIRKLSSKPLKK
PLESSNRTPLKTSVCEFGGKISYTQNYK
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggagcatgagattctccttgcttgtaacatcggtgatcttccctggctaaaagcatct
gttgaagaatcaaagaaagaaataaatgaaatttacaacaatgagggcttgactccacta
cacttggctgcttataccagaaacattcctatactgaagtaccttatctccaaagaacta
gacataaactcctcaacgttgtacactgctaacacaccacttcatctagtactgctgagc
tcctcatgcagtgtagataatgaaggccaggctattagagactgtgtgcaactcttactg
agccaaggagctcaatgcaacaagaggaactccaatgggcagactgtattgcatttagca
gccaaggcagggattgtgtacattgttagactgctccttgactatgaggcagatttcact
cttaaagatgataggaatcaaacaccttatgacattgcttgtctttatggcaaccacgag
tgtgccaggttacttagggcactccactgggcaagagagaaggatattcatgcaaagaga
aagttgcaatcagaaagggaaacccaaaggcaaaaggtcctttgcaaaacaatacaaaac
caactacgaaaacaagaagcagaaaatgcatatgatgaatggctttgtagaaataacttc
tctttgccccctcctcctcctcctcctcctcgctccaccagttgtttatcatgtgaaacc
tgtagctctatcactcaactggacagcatcactcaaatggacagcctcgatactgcagta
cagtcaattcattcaagcaatgaaccaaagatagcaaaaatacaaatatcgtttaaccaa
gctgagcacaacaccgctccagttggaaagccgcacaagctttatccttattcgaattat
cctccaaagcagtaccgatgtcataccaagacagagggtcatgtagagtctagaaatcag
cgtccttttagttctgcatcgaaccgtcgtccatcaaaaagagttgtatctcatgtgagg
attaaaagtgctccaactcgaattgcaataggaactgaacaaatgcagtctaagtccaag
agcaaaatgccacacacaagaaagatcattcacaaggccacgagtgtcaatggagagact
tataatgatattaatggtcaaacagaaactatgccatcactaattgatacagaaaaaaag
gaagagaatgttgtagtactaacagaagaggcactcaaggaaactacaaaagatgatgca
aatgatgaagatggtagttcaacgtcactcgatggacttacctttcatgatgtaggacca
gaaaatgacctaaaatcattagccagtcctgttagcaatgctagtggaagaggagcagct
tcttctatcaatccagttgagtttttacgtgtactatcagagttatcatctcaaagaact
cacagccgttcacatgggaaatacaaaccctctacttcaataaagtatgacagacggttt
agtcttggctctatccccgaaggagaaatggtaactaactataatcaagtcgaaggatct
ctagtctttgatgatgactttttacacaacttaatgccttttgcatttgacagcagtcac
tttcaagggacagaagagcccccatcagatcatgaatcacctcctcatactcctattgag
agatctgctccatccgtaaaattggcatgggacaatagcacaccacgaactcctgataaa
tcccgagttgtgtctcctgctaattctattagaaagttatcgtcaaagccgctaaagaag
ccattggaatcatcaaacagaactccactcaaaacgtcagtgtgtgaatttggcggcaaa
atcagttacactcaaaattataaatag

DBGET integrated database retrieval system