KEGG   Agrobacterium radiobacter: Arad_0243Help
Entry
Arad_0243         CDS       T00850                                 

Gene name
pit
Definition
(GenBank) phosphate transporter protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Arad_0243 (pit)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACM24981
UniProt: B9JGY5
Position
1:complement(219120..220727)
Genome map
AA seq 535 aa AA seqDB search
MVDVASSNAEGGNANHPIHGAGGSAKWFLPLFGVVVLGGLGYVGYALGNDLAEAATVPWI
LLGLALLIALGFEFVNGFHDTANAVATVIYTRSMPAEFAVIWSGFFNFLGVLTSSGAVAF
GILALLPVELILQVGSGSGLAMVFALLIAAIVWNLGTWYLGLPASSSHTLVGSIIGVGLA
NQFLAPAGSATSGVDWSQASSVGLSLLLSPLIGFGLAALLLLVSKALIRNKALYEAPKGN
APPPLWIRTLLIFTCTGVSFAHGSNDGQKGMGLIMLILIGLVPTAFALNRTPDINYLEAY
KAASTQVESVLGKYVKPGVAAPADPKAAVSDAVKNKTWTDTTTPALQAYIHATGIEIASY
PSVEKLPNGLVGNVRNDIYLIGEALKLIDKRKLLPMGADDLKAVTQYHAAVDNATKFIPL
WVKVAVALALGLGTMVGWKRIVVTVGEKIGKTHLTYGQGAAAEVVAMLTIGAADHLGLPV
STTHVLSSGVAGTMAANGSGLQWSTVRNMLMAWILTLPASIALAFTLFIVLRQVF
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatgtcgcttcaagcaatgcggagggtggcaatgccaatcatcctattcacggc
gcgggcggttccgccaagtggtttctgccgctcttcggcgtggtcgtgctcggtggcctt
ggctatgtcggctatgccctcggcaatgatctggccgaagccgcgactgtcccgtggatt
ctgctcggcctggcgctgctgatcgcactcggcttcgaattcgtcaacggcttccacgat
acggccaacgcggtcgccaccgtcatctacacccgctcgatgccggccgaatttgccgtt
atctggtcgggcttcttcaattttctcggcgtgctgacctcttccggcgccgtcgccttc
ggcattctggcgctgttgcccgtcgaattgattctccaggtcggctccggttccggtctc
gccatggtcttcgcgctgttgatcgccgcaatcgtctggaacctcggcacctggtatctc
ggcctgccggcctcgagctctcacacgctcgtgggctcgatcatcggcgtcggccttgcc
aaccagttcctcgcacccgcgggctcggccaccagcggcgtcgactggtcgcaggcgagc
agtgtcgggctgtccctgcttctatcgccgctgatcggctttggtctggcggccttgctg
ctgctggtctccaaggcgctgatccgcaacaaggcgctctatgaggcaccgaagggcaat
gcaccgccgccgctgtggattcgtacattgctgatcttcacctgtaccggcgtcagcttc
gcccatggctccaatgacggccagaagggtatgggcctgatcatgctcatcctgatcggc
ctggtgccaaccgcttttgccctcaaccgcacgcccgacatcaactatctcgaagcctac
aaggccgcctcgacgcaggtcgagtccgtgcttggtaaatatgtgaagccaggcgttgct
gcgccggccgatccgaaggctgccgtcagtgacgcggtgaagaacaagacctggactgac
accacgacgccggcgctgcaggcctatatccacgccaccggcatcgagatcgcttcctat
ccttccgtcgagaagctgccgaacggcctggtcggcaacgtccgcaacgacatctacctg
atcggcgaagccttgaagctgatcgacaagcgcaagctgctgccgatgggcgcggatgac
ctgaaggcggtgacgcaatatcacgccgccgtcgacaatgcgacgaagttcatcccgctc
tgggtgaaggtcgccgtggcgctggcgctcggccttggcacgatggtcggctggaagcgc
atcgtcgtcaccgtcggcgagaagatcggcaagacgcacctcacctacggccagggcgcc
gccgccgaagtcgtcgccatgttgacgatcggtgccgccgaccatctcggcctgccggtg
tccaccacccatgtcctgtcctcgggtgtcgccggcaccatggccgccaacggctccgga
ctgcaatggtcgaccgtccgcaacatgctgatggcctggatcctgacgctgcccgcctcg
atcgcgcttgccttcacgctgttcatcgtgctccgccaggtgttctga

DBGET integrated database retrieval system