KEGG   Agrobacterium radiobacter: Arad_0815Help
Entry
Arad_0815         CDS       T00850                                 

Gene name
fadA
Definition
(GenBank) acyl-CoA thiolase protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00071  Fatty acid degradation
ara00072  Synthesis and degradation of ketone bodies
ara00280  Valine, leucine and isoleucine degradation
ara00310  Lysine degradation
ara00362  Benzoate degradation
ara00380  Tryptophan metabolism
ara00620  Pyruvate metabolism
ara00630  Glyoxylate and dicarboxylate metabolism
ara00640  Propanoate metabolism
ara00650  Butanoate metabolism
ara00900  Terpenoid backbone biosynthesis
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
ara01212  Fatty acid metabolism
ara02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Arad_0815 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    Arad_0815 (fadA)
   00640 Propanoate metabolism
    Arad_0815 (fadA)
   00650 Butanoate metabolism
    Arad_0815 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Arad_0815 (fadA)
   00072 Synthesis and degradation of ketone bodies
    Arad_0815 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arad_0815 (fadA)
   00310 Lysine degradation
    Arad_0815 (fadA)
   00380 Tryptophan metabolism
    Arad_0815 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Arad_0815 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arad_0815 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Arad_0815 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ara04147]
    Arad_0815 (fadA)
Enzymes [BR:ara01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Arad_0815 (fadA)
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arad_0815 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Polysacc_deac_2
Motif
Other DBs
NCBI-ProteinID: ACM25422
UniProt: B9J920
Position
1:669895..671103
Genome map
AA seq 402 aa AA seqDB search
MTEVFIYDHVRTPRGRGKKDGSLHEVPSVRLAAKTLEAIRDRNGLDTGTVDDIIMGCVDP
VLDAGAVIPKAAAFEAGYSTTAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAANA
WEKGYFKNSVVPVKDINGLTILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGESMGLKPRGRIKAFANIGSDPALMLT
GPVDVTEKLLKRTGMSLADIDLFELNEAFAAVVLRYMQAFDISHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNVALVTLCIGAGMGTATIVERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggttttcatttacgaccatgttcgcacgccgcgcgggcgtggcaagaaggat
ggatcgctgcacgaagtaccgtccgtccgtctggccgccaagacgctggaggcgatccgc
gatcgcaacgggctggacaccggaacggtggacgacatcatcatgggctgcgtcgatccg
gttctggacgccggcgccgtcatcccgaaggcagctgctttcgaggcgggatattcgacc
accgcacccggcatgcagatctcgcgcttctgcgcttccggcctcgatgccgtgaatttc
ggcgcggccaagatcgcgcaaggggctgacgatatcgtcatcgccggcggcgtcgagagc
atgtcgcgcgttggcctcggcatgtccggcggcgcctggttcatggacccctctgtcaat
ttcccggcttatttcatgccgcagggcgtctccgccgacctgatcgccaccaaatacggc
ttctcccgtgatgatgtcgacgcctatgccgtcgagagccagaagcgggcggcgaatgcc
tgggagaagggttatttcaagaattccgtcgtgccggtgaaggatatcaacggcctgacg
atcctcgacagggatgagcatatgcgccccggtacggacatgcaggcgctggcctcgctc
aacccgtccttccagatgcccggcgagatgggcggtttcgaagctgtcggcatccaggcg
catccggaaatcgaacgcatcaactatgtgcatcatgccggcaattcctcagggatcgtc
gacggtgcggcggctgtattgctcggctcaaaggcgggcggtgagagcatggggctgaag
ccgcgtggccgcatcaaggcctttgccaatatcggctccgacccggcgctgatgctgacc
ggcccggtcgacgtcaccgagaagctgttgaagcgcaccggcatgtcgctggccgatatc
gatctgttcgagctcaacgaagcctttgccgccgtcgtgctgcgctacatgcaggctttc
gacatttcgcatgacaagatcaacgtcaacggcggcgccatcgccatgggccatccgttg
ggcgccaccggcgcgatgatcctcggcaccgtgctcgacgagctggaacgccgcgatctg
aacgtggcgctggtcacgctctgcatcggcgccggcatgggcacggccacgatcgtcgaa
cgcgtctga

DBGET integrated database retrieval system