KEGG   Agrobacterium radiobacter: Arad_0816Help
Entry
Arad_0816         CDS       T00850                                 

Gene name
fadB2
Definition
(GenBank) enoyl-CoA hydratase protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00071  Fatty acid degradation
ara00280  Valine, leucine and isoleucine degradation
ara00281  Geraniol degradation
ara00310  Lysine degradation
ara00362  Benzoate degradation
ara00380  Tryptophan metabolism
ara00410  beta-Alanine metabolism
ara00640  Propanoate metabolism
ara00650  Butanoate metabolism
ara00903  Limonene and pinene degradation
ara00930  Caprolactam degradation
ara01040  Biosynthesis of unsaturated fatty acids
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
ara01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Arad_0816 (fadB2)
   00650 Butanoate metabolism
    Arad_0816 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    Arad_0816 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    Arad_0816 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arad_0816 (fadB2)
   00310 Lysine degradation
    Arad_0816 (fadB2)
   00380 Tryptophan metabolism
    Arad_0816 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arad_0816 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arad_0816 (fadB2)
   00281 Geraniol degradation
    Arad_0816 (fadB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arad_0816 (fadB2)
   00930 Caprolactam degradation
    Arad_0816 (fadB2)
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Arad_0816 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Arad_0816 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Arad_0816 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 NAD_binding_8 NAD_binding_7 UDPG_MGDP_dh_N Pyr_redox Pyr_redox_2 FAD_binding_3 2-Hacid_dh_C AlaDh_PNT_C ApbA
Motif
Other DBs
NCBI-ProteinID: ACM25423
UniProt: B9J921
Position
1:671118..673328
Genome map
AA seq 736 aa AA seqDB search
MAYTNFTIETDADGIALVTWDMPGKSMNVFTSEVMDELNAIIDATVADAAVKGVVFTSSK
SSFSGGADLSMIKSMFSFYQDEKAKEPAGAAQKLFDLVGRMTGLFRKLETCGKPWVSAIN
GTCMGGAFELSLACHGRVASSAKSVKIALPEVKVGIFPGAGGTQRVSRLTDAQSALQMMT
TGQSLTAVRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAPWDEKGFKAPGGGIWTPAS
AQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTQVLQTTEAYSM
IRSLFISMQELGKGARRPAGQLKTVLKKVGVVGAGFMGASIAYVTAAAGLSVTLIDRDLE
AAGKGKSVGEGLVKDAVGKGRMTQEDGAALLSRITPSATYADLSDADLVIEAVFEDREVK
KAVIEAVEAVLPEGAIFASNTSTLPISGLAKNSKRPADFIGVHFFSPVEKMMLTEVILGK
ETGDRALAVALDYVAAIKKTPIVVNDTRGFFVNRCVFRYIHEAYDMLIEGVPATMIENAA
KMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKAVDPRHMQLISRLVEGEGRLGRKNS
KGFYDYPPKPAKKSLWLGLKDLYPQKKADEIDVAVLKQRFLATIALEAARTMEEGIVTDP
READVGSILGFGFAPYTGGALSYIDGMGVKAFVSLCETLAKTYGPHFAPTALLKDMAAKG
ETFYGRFDPYSVKAAA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacaaatttcaccatcgagaccgacgcagacggcatcgcgctcgttacctgg
gacatgcccggaaaatccatgaacgtcttcacctccgaggtgatggacgaactgaacgcc
atcatcgacgcgaccgttgccgacgcggcggtcaagggcgtggtcttcacctcgagcaag
tcctccttctccggcggcgctgatctctcgatgatcaagtcgatgttctccttctatcag
gatgagaaggcgaaagagccggccggcgccgcgcagaaactcttcgatcttgtggggcgc
atgaccggcctcttccgcaagctcgaaacctgcggcaagccgtgggtttccgccattaac
ggcacttgcatgggtggtgccttcgagctgtcgctggcctgccacggccgcgttgcgtcc
agcgcgaaaagcgtcaagatcgctctgccggaagtcaaggtcggcattttccccggcgct
ggcggcacgcaacgtgtgtcgcgattgaccgacgcgcaatcggccttgcagatgatgacg
acaggccagtcgctgacggcggtgcgcgccaaggcaatgaacctggttcatcaggtggtc
gagccggatcagttgatcccggccgccaagcagatgatcaaggacgggctgaagccggtc
gcaccctgggacgaaaagggcttcaaggcccccggcggcggtatctggacgccggcctcg
gcccagctctggccggctgctccggccatcctgcgccgagagacatcgggcaattatccg
gcggcgctcgccatcctaaaatgtgtctatgaaggcctccaggtgcctttcgacaccggc
ctgaagatcgagcaacgctatttcacccaggtgctgcagaccactgaagcctattcgatg
atccgctcgctgttcatctccatgcaggaactcggcaagggtgctcgccgcccggccgga
cagctgaagacggtgctgaagaaagtcggcgtcgtcggtgccggcttcatgggtgcttcc
atcgcctatgtcacggccgcggccggcttgtccgtgacgctgatcgaccgcgatctggaa
gctgccggcaagggcaagagcgtcggcgaaggtctggtgaaggatgctgtcggtaaggga
agaatgacgcaggaagatggcgcggcgctactctcccgcatcacgccgtctgccacctat
gccgatctcagcgatgccgatctcgtcatcgaagcggtcttcgaggatcgcgaagtcaaa
aaagcggtcatcgaggcggtcgaagccgtgctgccggaaggcgccatctttgcctccaac
acctcgacgctgccgatctctggccttgcgaagaactccaagcgtccggccgattttatc
ggcgtccatttcttctctccggtcgagaagatgatgttgaccgaagtcatcctcggcaag
gaaacgggcgaccgcgcccttgccgtggcgctggattacgtcgccgcgatcaagaagacg
ccgatcgtcgtcaacgacactcgtggctttttcgtcaatcgctgcgtcttccgctatatc
catgaagcctatgacatgctgatcgaaggcgtgcccgcgaccatgatcgaaaacgccgcc
aagatggccggcatgccggttggccccctggcactcaacgacgaagtcgctatcgaccta
tcgctgaagatcctcaaggcgaccgtcgccgacctcggcgagaaagcagtcgatccgcgc
cacatgcaactgatcagccgtctcgtggaaggtgagggccgtctgggccgcaagaactcc
aagggcttctatgactacccgccgaagccggctaagaaatcgctgtggctgggcctgaag
gacctctatccgcagaagaaggcggacgagatcgatgtcgccgtcctgaagcagcgcttc
ctcgccaccatcgcgctcgaagccgcccgcaccatggaagagggcatcgtcaccgatccg
cgcgaagccgatgtcggctccatcctcggcttcggcttcgccccctataccggcggcgcg
ctctcctacatcgacggcatgggcgtcaaagccttcgtgagcctttgcgaaacgctggcc
aagacctacggcccgcacttcgcgccgacggcgctgctcaaggatatggcagccaagggc
gagacgttttacggacgatttgatccgtacagcgtgaaagctgcagcctga

DBGET integrated database retrieval system