KEGG   Agrobacterium radiobacter: Arad_12071Help
Entry
Arad_12071        CDS       T00850                                 

Gene name
avhB9a
Definition
(GenBank) type IV secretion protein
  KO
K03204  type IV secretion system protein VirB9
Organism
ara  Agrobacterium radiobacter
Pathway
ara03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ara00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Arad_12071 (avhB9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ara02044]
    Arad_12071 (avhB9a)
Secretion system [BR:ara02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Arad_12071 (avhB9a)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACM31145
UniProt: B9JPS6
Position
pAtK84c:50642..51403
Genome map
AA seq 253 aa AA seqDB search
MLARPPIVLAEVQPQSVRADARIRTVPFQKDNVVYLAGMMGVSTMIVFNEDEQIATVAMG
DSLAWQAVPDQSKRFLFIKPLQPDAQTNMNVVTSKRVYTFFLNGAKPGNTKTAVIKLRFS
YPEDSLDANLLAAARQNAAMPNVRAALANPGRINYDYGYKGAVDARPTSMFDDGTKTFFQ
FSGEVPAFFAVKSDGSESLVNYRREGDYIVVDKVARQWTLRSGNVVTCVFNMKPPIGALK
PANGKPQEISHGH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcccgccgatcgttttggcggaagtccagccgcaatcggtgagggccgac
gcccgcattcgcaccgtaccgttccagaaggacaatgtcgtctatctcgctggcatgatg
ggcgtgtctacgatgattgtcttcaacgaggacgaacagatcgcgacggttgccatgggt
gacagcctcgcctggcaggcagtcccggatcagtcgaagcgcttcctgttcattaagcca
ctgcagcctgacgcgcagactaacatgaacgtcgtgacgtcgaagcgggtctatacgttc
tttctgaacggagcgaagcccggcaacacgaaaaccgccgttattaaactccgcttttcc
tatccggaggattcgctagatgccaatctgctggcggccgcccgccagaatgcggccatg
ccgaacgtccgcgcggctttggcaaaccccggccggatcaactacgactatggctataag
ggcgctgtcgatgccaggccgacctcgatgttcgatgacggcacgaagaccttctttcaa
ttcagcggagaggttccggcattcttcgccgtcaaatccgatggcagcgagtctctcgtc
aactaccggcgcgagggcgactacatcgtcgtcgacaaggttgcccgccaatggaccctg
cggtccggcaatgtcgtgacctgtgtcttcaacatgaagcccccgatcggcgccctgaag
ccggcaaacggtaagccgcaggagatcagccatggccattga

DBGET integrated database retrieval system