KEGG   Agrobacterium radiobacter: Arad_12248Help
Entry
Arad_12248        CDS       T00850                                 

Definition
(GenBank) Glycoside hydrolase, family 3, N-terminal:Glycoside hydrolase, family 3, C-terminal
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00460  Cyanoamino acid metabolism
ara00500  Starch and sucrose metabolism
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Arad_12248
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Arad_12248
Enzymes [BR:ara01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Arad_12248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: ACM31268
UniProt: B9JQ49
Position
pAtK84c:184912..187215
Genome map
AA seq 767 aa AA seqDB search
MTDLATETLRLDDKDNEALSLTTGADYWTTTNAPSYGIRSMRLADGPHGLRVQDDENPDH
LGLERSAQATCFPPAVTLASSWDIDLIEAVGNALGREARAAGVNVVLGPGLNIKRSPLCG
RNFEYYSEDPLLAGVLAGAAARGLQAQGVAACLKHFAVNNQETDRLRVSANIDERPLREI
YLRAFQIALEESAAWSVMSSYNRINGVFASQNHWLLTDLLRNEWGFDGVMISDWGAVRDP
VDAFKAGLDLRMPGRPDDNRIRQAWARGEIDAVLLDQTVGRMRLLCDRTSIAAPAVDVDR
NDHHKLVQKAAAESAVLLSNDGVLPLALKPGIRIAVVGELARQPRYQGAGSSRVNAIKVV
SSLDALSARVHKAGAELEFASGYTLSGSSDHALIDEAIELAQRSDVVILFMGLPGEFEAE
GRDRTTIQLPANQTALISALQGTKSKVVVALSNGSVVTTSSWRNGVNAIVEFWLTGQAHG
DTVADVLLGVVNPSGKLAETVPIRLEDTPAFLSFPGEHQNVDYGEGIYVGYRYYDARSID
VDYPFGHGLSYTTFEYSGLEILVRPLSDVVAFDAKIRIHNTGERFGHEVVQLYVQDLQTE
ITTPPRELRGWKKIGLAPGEEATVEIAVTREQLSHWHTPNKCWVYPGSDLIVCVGGSSRD
LPLKKTVTIPGEAISLKLDEWATFGEWLDDPKLGLKLRELIEARGGLKGRMADLLADEGG
GRDAVRAVPLATIVEFPGVPVALDDLRILSSSLTGANDGSRSPGTRL
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttggccactgaaacgctccgactggatgacaaagataatgaagctttgtcc
ctgaccactggtgccgattactggacgacgacaaatgctccaagttacggaatccgatcc
atgcgtcttgccgacgggccgcatggactgcgtgttcaagatgatgagaatccggaccat
ctcgggcttgaacgcagtgcgcaggcaacatgttttcctccagcggtgacactcgcgtct
tcgtgggacatcgaccttatcgaagcagtcggcaatgctctgggaagggaggcccgtgct
gcgggcgtgaacgttgtgcttggaccgggactgaatatcaaacggagccctttgtgcggg
agaaactttgagtattactcagaggatccccttcttgcgggtgttctcgcgggagcggcc
gcacgcggcctgcaggctcaaggtgtcgctgcatgcctcaagcattttgcggtcaacaat
caagagactgatcgtctcagagtgagtgcgaatatcgatgagcgccctcttagagaaatt
tatctgcgagcttttcaaatcgctcttgaagagtccgcagcctggtcggtgatgtcttca
tataatcgcatcaatggagtgtttgcctcacaaaaccattggctgctgacggacctactt
cgcaatgaatggggcttcgatggcgtaatgatatcggactggggcgcagttcgtgatccg
gtagacgcatttaaagcgggtcttgacttgcgtatgcctggtcgtccggacgataaccgc
atacgccaggcttgggctcgcggagaaattgatgctgtcttgttggatcaaactgtgggc
aggatgcgcctcctttgcgaccgcacttcaatagcagcacctgcggtcgatgtggatcgc
aacgatcatcataaactcgtccagaaggccgccgctgaatccgcagtgcttctttcaaac
gatggtgttctgccattggctctgaagccaggtattaggatcgcagtcgttggtgaactg
gcgcggcaaccgagatatcagggtgccggcagttcgcgtgtcaatgcaatcaaggttgta
agcagtctggacgccttgtctgcgagggtccacaaggcaggcgcggaactcgaattcgcg
agtggttacacgctctcaggctcaagcgatcacgcattgattgatgaggctattgaattg
gcgcaacgctccgacgttgttatcttgtttatgggactgcccggtgaatttgaagcggaa
ggccgggacagaacaacgatccaactaccagcaaatcagacggcgcttatcagtgcctta
caaggcacaaaatccaaagtcgttgtcgctctgagtaatggctcggtcgttacaacctcc
tcgtggcgaaacggtgtgaacgcgatagtggagttctggcttacgggtcaggcgcatggc
gatacagtagctgatgtgctgctgggcgttgtaaatccgagcggaaagcttgcggaaacg
gtgccaatccgtctggaagatacaccagcttttctgagttttccaggcgagcatcagaac
gtggattacggtgaaggcatctatgtcggctaccgctactatgatgcccgtagcattgac
gttgactacccgttcggtcacggattgtcgtacacgacttttgaatattctggcctggag
atactcgttcggcctttgtccgatgtcgtcgccttcgatgcgaaaatcaggatccacaac
accggcgaacgttttggtcatgaagtcgttcagctatacgttcaggatctccagaccgaa
atcacgacacctccgcgcgaattgcgaggctggaaaaagatcggcttggcgcctggtgaa
gaagcgaccgtggaaatagcggtcactagggagcaactgtcacattggcatactccgaac
aagtgctgggtatatcctggcagtgacctaatcgtatgcgttggcggctcgtccagagat
ctaccactaaagaaaacggtcacaatcccgggggaagcgatctcgctgaagctcgacgaa
tgggcaactttcggcgaatggctcgatgacccgaaactagggctcaagctccgcgaactc
atcgaggcgcgcggcgggctcaagggccgtatggcagatcttctagcagacgagggtggg
gggcgagatgcggtgcgcgccgtcccactggcgaccatagtcgaatttccaggtgtccct
gttgcccttgacgatctcagaatactctcaagcagcctgacgggtgcgaacgacggaagt
cgatcgccgggcacaaggctttag

DBGET integrated database retrieval system