KEGG   Agrobacterium radiobacter: Arad_1624Help
Entry
Arad_1624         CDS       T00850                                 

Definition
(GenBank) ABC transporter
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_1624
Transporters [BR:ara02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Arad_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_22 AAA_16 RsgA_GTPase AAA_33 Zeta_toxin AAA_21 AAA_29 ABC_ATPase AAA_18 AAA_24 MMR_HSR1 AAA_25 AAA_15
Motif
Other DBs
NCBI-ProteinID: ACM26017
UniProt: B9JC96
Position
1:complement(1291091..1292977)
Genome map
AA seq 628 aa AA seqDB search
MADRKKTISADSSNPLNTLVNLWPYMWPTGRMDLKMRVVWATVYLLISKFFLLLVPYFFK
WSVDALNGKLDMQGILPAFMVGALALIVATNVTRLIQLGLNQLRDSLFASVGQYAVRQLA
YRTFVHIHELSLRFHLERKTGGLSRVIERGTKGIETIVRFTILNTVPTFVEFLLTAIIFW
RGYGFSYLAITAVTVWLYIWFTVKASDWRISIRRTMNESDTDANTKAIDSLLNFETVKYF
GNEEMEAKRFDQSMARYEKAATGVWTSLGWLNFGQGVIFGLGTTVMMVVSGWAVLNGHQT
VGDFVFINAMLLQLSVPLNFIGFVYREIRQGLTDIEEMFDLLEVKPEVTDAPDARELVIG
QGAISFKDVHFAYDAARPILKGISFEVPAGKTVAVVGPSGAGKSTLSRLLYRFYDVQSGT
ITIDDQDLRTVTQKSLRKVIGMVPQDTVLFNDTIAYNIRYGRTGASEDEVMAAAEIAQIG
DFIRQLPEGFETKVGERGLKLSGGEKQRVAIARTVLKAPPVLILDEATSALDTTTEQEIQ
TALDVVSKNRTTLVIAHRLSTVIGADEIIVLKSGEIAERGTHAVLLEQNGLYASMWNRQR
EATQAEEHLKQVRENDDLGVVNRLAPAR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgcaagaaaaccatatcggcggatagcagcaatccattgaatacgctcgtc
aatctctggccctatatgtggccgacggggcgcatggacctgaagatgcgggtcgtctgg
gcgaccgtctatctgctgatctcgaaattcttcctgctgctggtcccgtatttcttcaaa
tggtccgtcgatgcgctaaacggcaagctggacatgcagggcatcctgccggccttcatg
gtcggcgccctcgcgctcatcgtcgccaccaacgtcacgcgcctgatccagctcggtctc
aaccagcttcgcgactcgctctttgccagcgtcggccaatatgccgtgcgccagctcgcc
taccggaccttcgtgcacattcatgagctgtcgctgcgctttcatctcgagcgcaagacc
ggcggtctgtcgcgcgtcatcgagcgcggcaccaagggcatcgagacgatcgtccgcttc
accatcctcaacaccgtcccgaccttcgtcgagtttcttttgaccgcgatcatcttctgg
cgcggctacggcttttcctatctcgccatcacggcggtcacggtctggctctatatctgg
ttcaccgtcaaggcgagcgactggcgcatctccatccgccggacgatgaacgagagcgat
acggacgccaacaccaaggcgatcgattctctcctgaacttcgagacggtcaaatatttc
ggcaacgaggagatggaggccaagcgtttcgaccagtcgatggcgcgttacgagaaggcc
gccaccggcgtctggacgtcgctgggctggctgaacttcggtcagggcgtcatcttcggc
ctgggcaccacggtcatgatggtcgtctccggctgggccgttctcaacggccaccagacg
gtcggcgacttcgtcttcatcaatgccatgctgctgcagctttccgtgccgctcaacttc
atcggcttcgtctaccgcgaaatccgccagggtctgactgatatcgaggagatgttcgac
cttctggaggtaaagcccgaggtgacggacgcacccgacgccagggaactggtcatcggc
cagggcgccatttccttcaaggatgtgcatttcgcctatgacgccgcccggccgatcctc
aagggcatctccttcgaggtgccggccggcaagactgtcgccgtcgtcggcccctcgggc
gccggcaaatccaccctgtcgcggctgctctaccgcttctacgacgtccagagcggtacg
atcaccatcgacgatcaggatctgcgcacggtgacgcagaagagcctgcgcaaggtgatc
ggcatggtgccgcaggacaccgtgcttttcaacgacaccatcgcctacaacatccgctac
ggacggacgggtgcgagcgaggacgaggtgatggcagcagccgaaattgcccagatcggc
gactttatccgccagttgcccgagggtttcgaaaccaaggtgggcgaacgcggcctgaaa
ctttccggcggcgaaaagcagcgtgtcgccattgcccgcaccgttctcaaggccccgccg
gtgctcatcctcgatgaagcgacctcggcgctggacaccacgaccgaacaggaaatccag
acggccctcgacgtcgtctccaagaaccgcacgacgctggtcatcgcccaccggctctcc
accgtcatcggcgccgacgaaatcatcgtgctgaaaagcggcgagatcgccgaacgcggc
acccatgccgtccttctggaacagaacggcctctacgcctcgatgtggaaccgccagcgc
gaggcaacgcaggccgaagaacatctgaagcaggtgcgcgagaacgacgacctaggcgtg
gtcaaccggctagcgccggcgcgctga

DBGET integrated database retrieval system