KEGG   Agrobacterium radiobacter: Arad_1629Help
Entry
Arad_1629         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K05786  chloramphenicol-sensitive protein RarD
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_1629
Transporters [BR:ara02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Arad_1629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA DMT_6
Motif
Other DBs
NCBI-ProteinID: ACM26020
UniProt: B9JC99
Position
1:complement(1295990..1296901)
Genome map
AA seq 303 aa AA seqDB search
MATDTVAPDVKNEDSLRGFGFALTAYLFWGVLPLYMKALAHIPATEIVAHRILWSVPVAG
VVLLALGRMGDIKAALSSPRTVAMVSLTATLVTINWGTYVWAISAGHSLDAALGYFINPL
FSIALGALLLKEKLAPLQIAAICLAAAAVVILTIEAGTVPWVALTLTLSWGFYAFFRKTL
PVGANQGFFLEVLLLCIPATLYILYLEARGEGHLYRTGISDTALLLGCGLVTALPLMIFA
NGAKLLRLSTIGIMQYIAPTMIFLIAVFVFKEPFGTTQMIAFSLIWAGLVLYSWSMLRQS
RAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgacacggtcgcacctgacgtcaagaacgaggacagcctgcgcggcttcggc
ttcgcgctgacggcctacctcttttggggcgtcttgccgctctacatgaaagccttggcg
catattccggccacggagatcgtcgcccaccgtattttatggtccgtacccgttgccggg
gtcgtgcttctggcgctcggtcgtatgggcgatatcaaggcggcactcagcagtccacgc
acggtcgccatggtatcgctgacggcgacgctggtgaccatcaactggggaacctatgtc
tgggcgatcagcgccggacattcgctcgacgcggcgctcggctacttcatcaatccgctg
ttcagcatcgcgctcggcgccctgctgttgaaggagaagctggcaccgctacagatcgcc
gcgatctgccttgcagcggcagcggtggtcattctgaccatcgaggccggcaccgtgccc
tgggtggcgctgacgctgaccttatcctggggcttctatgcctttttccgcaagacgctg
ccggtaggggcaaaccagggcttcttcctggaggtgctgctgctctgcattccggctacg
ctttacatcctctatctggaagcgcgcggcgaaggccatctctaccgcacgggcatctcg
gatacggcgcttctgctcggttgcggcctggtgaccgccctgccgctgatgatcttcgcc
aatggagcgaagctactcaggctctccactatcggcatcatgcagtatatcgcgccgacg
atgatcttcctcatcgccgtcttcgtattcaaggagcctttcggcacgacgcagatgatc
gccttctcgctgatctgggcggggctggtgctctatagctggtcgatgctgcgtcaaagc
cgggcacgctaa

DBGET integrated database retrieval system