KEGG   Agrobacterium radiobacter: Arad_1655Help
Entry
Arad_1655         CDS       T00850                                 

Gene name
rplI
Definition
(GenBank) ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
ara  Agrobacterium radiobacter
Pathway
ara03010  Ribosome
Module
ara_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ara00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Arad_1655 (rplI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ara03011]
    Arad_1655 (rplI)
Ribosome [BR:ara03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Arad_1655 (rplI)
  Bacteria
    Arad_1655 (rplI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N
Motif
Other DBs
NCBI-ProteinID: ACM26037
UniProt: B9JCB6
Position
1:complement(1314498..1315079)
Genome map
AA seq 193 aa AA seqDB search
MEVILLERISKLGQMGEVVKVRDGFARNYLLPLGKALRANAANKTRFEAERATLEARNLE
RKSEAQKVADVLGGKSFIVVRSAGETGQLYGSVAARDVVEILAAEGFNIGRSQVHMNTPI
KAIGLHAVAIGLHAEVEITVELNVARSAEEAERQTKGETLTSADAIYGIDEDALRPEDFF
DPEADGNAEDDDA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcattctcctggagcgcatctccaagctcggccagatgggcgaagtggttaag
gttcgcgacggctttgcccgtaactacctgctgccgctcggcaaggcgctccgcgccaac
gccgccaacaagacccgtttcgaagctgagcgtgcaacgctcgaagcccgtaaccttgag
cgcaagagcgaagcccagaaggttgccgacgttctcggcggcaagtccttcatcgtcgtt
cgctcggctggcgaaaccggccagctctacggttcggtcgctgcccgtgacgtcgttgaa
atcctcgctgctgaaggcttcaacatcggccgtagccaggttcacatgaacacgccgatc
aaggccatcggcctgcacgccgttgcgatcgggcttcatgctgaagtcgaaatcaccgtc
gagctcaacgttgcccgttctgctgaagaagccgaacgtcagaccaagggcgaaaccctc
acctccgctgacgccatctacggcatcgacgaagatgccctgcgtccggaagacttcttc
gatccggaagccgacggcaacgccgaagacgacgacgcataa

DBGET integrated database retrieval system