KEGG   Agrobacterium radiobacter: Arad_1656Help
Entry
Arad_1656         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2232 GWT1
Motif
Other DBs
NCBI-ProteinID: ACM26038
UniProt: B9JCB7
Position
1:complement(1315100..1316155)
Genome map
AA seq 351 aa AA seqDB search
MLGTAFGPECRKHPLTAHTKQDSDVKNLNAKVLAIGALAGFTAALLVYGATVQPLLFILF
GALSALPILIVGLGWGNIAVITAVVTAGIVGAVGQSPSFGLFAVLMALVPAWLSHLANLA
RPASELGGPEHLTAWYPLSDIMLHLCGLAAAVIVIVGAIMGYNADLVGQVVDAYVSVMNQ
QPQPELQLNPAVIDKTKSLMLYAIPLVWGMIWVMMLLAAYYMAIRIVAASSRNLRPREDI
PSALRMNRNAIFVFLAAVVAMFFGGIPALIGAATLGAFGAGFIVSGFASLHYRTRGKDWR
IPVLILCYLTSLMLTVPLFIILVLGLYDTRKAIALTPNKNAEIPKQPDTKI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgttggggacggcttttggaccagagtgtcggaagcatcctctaactgctcatacgaag
caggacagcgacgtgaaaaatttgaacgctaaagtgctggctatcggcgccctcgccggt
tttaccgctgccttactcgtgtatggcgcgacggtacagccgttgctgttcatcctattt
ggcgcgctctccgccctccctattctcattgtcggcctcggctggggcaacattgccgtc
atcaccgccgtcgttacggccggcattgtcggcgcggtcggccagtcgccgtccttcggg
cttttcgccgtactcatggcgctggtgccggcctggctcagccacctggccaatctcgca
cgtcccgcctccgaactcggcggccccgagcatctgacggcctggtatccgctctcggac
atcatgctgcatctctgcggccttgccgccgccgtcatcgtcatcgtcggcgcgatcatg
ggctacaacgccgatctcgtcggtcaggtggtcgatgcctatgtcagcgtcatgaaccag
cagccgcagcccgagcttcagctcaatccggcggtgatcgacaagaccaagtcgctgatg
ctctacgccattcccctcgtctggggcatgatttgggtcatgatgctgctggccgcctac
tacatggccatccgcatcgtcgcagcctccagccgcaacctgcgcccgcgcgaggacatt
ccctctgcgctgcgcatgaaccgcaacgcgatcttcgtctttctcgcggctgttgtcgcc
atgttcttcggcggcatcccggccttgatcggcgccgccacgcttggcgccttcggcgcc
ggctttatcgtttccggcttcgcttcgctgcattatcgcacgcgtggcaaggactggcgc
attcccgtgctgatcctctgctacctgacgtcgctgatgctgacggtgccgctcttcatc
atccttgttctcgggctctacgatacgcgcaaggcgatcgcgctcaccccgaacaagaat
gccgaaatacccaaacaaccagacacgaaaatctga

DBGET integrated database retrieval system