KEGG   Agrobacterium radiobacter: Arad_1657Help
Entry
Arad_1657         CDS       T00850                                 

Gene name
rpsR
Definition
(GenBank) ribosomal protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
ara  Agrobacterium radiobacter
Pathway
ara03010  Ribosome
Module
ara_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ara00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Arad_1657 (rpsR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ara03011]
    Arad_1657 (rpsR)
Ribosome [BR:ara03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Arad_1657 (rpsR)
  Bacteria
    Arad_1657 (rpsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S18 Med23
Motif
Other DBs
NCBI-ProteinID: ACM26039
UniProt: B9JCB8
Position
1:complement(1316245..1316493)
Genome map
AA seq 82 aa AA seqDB search
MSEVSSAPVRRPFHRRRKTCPFSGANAPRIDYKDVRLLQRYISERGKIVPSRITAVSQKK
QRELAQAIKRARFLGLLPYVVA
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtttcctccgcaccggttcgccgtccgttccatcgccgccgcaagacctgc
ccgttctcgggcgccaatgcgccgcgcatcgactacaaggacgtccgtctcctgcagcgc
tacatttccgagcgtggcaagatcgttccgtcccgcatcacggccgtttcccagaagaag
cagcgcgaactcgcccaggcgatcaagcgcgcccgtttcctcggcctgctgccttacgtc
gtcgcttaa

DBGET integrated database retrieval system