KEGG   Agrobacterium radiobacter: Arad_1658Help
Entry
Arad_1658         CDS       T00850                                 

Gene name
rpsF
Definition
(GenBank) ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
ara  Agrobacterium radiobacter
Pathway
ara03010  Ribosome
Module
ara_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ara00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Arad_1658 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ara03011]
    Arad_1658 (rpsF)
   03029 Mitochondrial biogenesis [BR:ara03029]
    Arad_1658 (rpsF)
Ribosome [BR:ara03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Arad_1658 (rpsF)
  Bacteria
    Arad_1658 (rpsF)
Mitochondrial biogenesis [BR:ara03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Arad_1658 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6
Motif
Other DBs
NCBI-ProteinID: ACM26040
UniProt: B9JCB9
Position
1:complement(1316507..1316959)
Genome map
AA seq 150 aa AA seqDB search
MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHY
ALMDIDAPAAAVHEMERQMRISEDVLRYMTIAVEKHEEGPSAMMQKRDRDDRPRRDGDRP
ERSFGDRDRGPRPDRGDREDRPRRPREDRV
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggctctttacgaacatgtattccttgcccgacaggatatttccgcacagcaggtcgat
gccctcgtagaacagtacaagggtgttatcgaagctaacggcggtaaagtcgggcgtatc
gaaaactggggcctcaagtcccttacctatcgcatcaagaagaaccgcaaggctcattac
gccctgatggacatcgatgcaccggccgctgccgtccacgaaatggaacgtcagatgcgt
atcagcgaagacgtcctgcgttacatgacgatcgctgttgaaaagcacgaagaaggcccg
tctgcgatgatgcagaagcgcgaccgcgacgaccgtccgcgccgcgatggcgaccgtccg
gagcgcagcttcggcgaccgtgatcgtggtccgcgcccggaccgtggtgatcgtgaagac
cgtccgcgccgtccgcgcgaagatcgcgtataa

DBGET integrated database retrieval system