KEGG   Agrobacterium radiobacter: Arad_1666Help
Entry
Arad_1666         CDS       T00850                                 

Gene name
fabD
Definition
(GenBank) malonyl CoA-acyl carrier protein transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00061  Fatty acid biosynthesis
ara01100  Metabolic pathways
ara01130  Biosynthesis of antibiotics
ara01212  Fatty acid metabolism
Module
ara_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Arad_1666 (fabD)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Arad_1666 (fabD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ara01004]
    Arad_1666 (fabD)
Enzymes [BR:ara01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     Arad_1666 (fabD)
Lipid biosynthesis proteins [BR:ara01004]
 Fatty acid synthase
  Component type
   Arad_1666 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 T7SS_ESX_EspC
Motif
Other DBs
NCBI-ProteinID: ACM26045
UniProt: B9JCC4
Position
1:1321597..1322538
Genome map
AA seq 313 aa AA seqDB search
MTVAFTFPGQGSQTVGMGKDLADNFAEARAVFEEVDEALGEKLSDVIFNGPEDKLTLTAN
AQPALMAVSIAVIRVLQARGLDLKSKVAYVAGHSLGEYSALCAAGTFSLADTARLLRIRG
NAMQAAVPVGVGAMAAIIGLEHADVVAVCTEASVLGACQIANDNGGGQIVISGEKAPVEK
AAELATAKGAKRAILLPVSAPFHSSLMAPAAEAMRVALADVAKSNPIVPLIANVRAAPVT
DAGEIANLLVEQVTGQVRWRETVEWFAAHNVTTLYEIGAGKVLTGLARRIDKSVNGIAVN
SAADIDTALASLL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgactgtagccttcacatttcccggccagggcagccaaactgtcggcatgggcaaggac
cttgcagacaatttcgccgaagcgcgcgccgtcttcgaggaagttgatgaagcgcttggt
gaaaagctctccgacgtcatcttcaatggtcccgaggacaagctgacgctgacggccaac
gcccagccggcgctgatggccgtgtcgatcgccgtcatccgcgttctgcaggcacgcggc
ctcgatctgaagagcaaggtcgcctacgtcgcgggccattcgctcggcgaatattcggcg
ctgtgtgccgccggcacgttctcgcttgccgatacggcgcggctgctgcgtattcgcggc
aatgccatgcaggcggcggttccggtcggcgtcggcgccatggcggcaatcatcggcctc
gaacatgccgatgtcgtcgctgtctgcacggaggcgtcggtccttggcgcctgccagatc
gccaacgacaatggcggcggccagatcgtcatttccggcgagaaggccccggtcgagaag
gctgctgaactggcaaccgccaagggtgccaagcgcgctatcctgctgccggtctccgca
cccttccattcctcgttgatggcgcccgccgccgaggcgatgcgcgtggcactcgccgac
gtcgcgaaatccaatccgatcgtgccgctcatcgccaatgtgcgcgctgctccggttacg
gacgccggcgagatcgccaatctgctcgtggagcaggtcaccggccaggtacgctggcgc
gagacggtggaatggttcgccgcccataacgtgacaacattgtatgagatcggcgccggc
aaggtgctgacgggacttgcacggcgcatcgataaatcggtgaacggcatcgcggtgaat
tcggccgccgatatcgataccgcgctcgcaagcctgctttaa

DBGET integrated database retrieval system