KEGG   Agrobacterium radiobacter: Arad_1672Help
Entry
Arad_1672         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07082  UPF0755 protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceG
Motif
Other DBs
NCBI-ProteinID: ACM26049
UniProt: B9JCC8
Position
1:1325424..1326641
Genome map
AA seq 405 aa AA seqDB search
MSDTNQSNGTPNGQKGPIIPKSANEALRPERVPDPPKRSRKARSQMVIFLNFLMTLVVFV
IVLAIIGAYYAISAYQSPGPLATNSNFIVRSGAGLAEISNRLEANNLISDARIFRYMTAT
NLHDGETLRSGEYEIKAGASMKDIMELLKSGKSILYSVTLPEGLTVRQIFNKLQADPVLE
GELPSALPAEGSLRPDTYKFTRGTKRTEIVQQMAGAQEKLVDQIWQKRDPNLTLANKQEF
VTLASIVEKETGLADERAHVASVFLNRIGKGMRLQSDPTIIYGLFGGDGKPSDRPIFQSD
LKKETAYNTYIIKGLPPTPIANPGRDALEAVANPWKTQDLYFVADGTGGHVFAATLEEHN
ANVKRWRKLVAEKGEDPSAIAVDGQPDDGAATTTGSGTQQKKKTN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatacgaatcagagcaacggaactccgaacgggcagaaggggccgattatcccg
aaatcggccaacgaggcgctgcgtccggagcgtgttccggatccgccgaagcgctcccgc
aaagcccgcagccagatggtgatcttcctgaattttttgatgacgctggtggttttcgtc
atcgttctcgcgatcattggtgcctattatgccatctccgcctatcagagccctggcccg
ctggcgaccaacagcaacttcatcgtgcgcagtggcgctggccttgccgaaatctccaat
cggctcgaagccaacaacctcatctccgacgcccgcatctttcgctatatgacggctacc
aatctgcatgacggagagaccctgcggtccggcgaatatgagatcaaggccggcgcttcc
atgaaggacatcatggagctgctgaaatccggcaagtcgatcctttattcggtcaccctg
ccggaagggctgacggtgcgccagatattcaacaagctgcaggccgacccggtgctggaa
ggcgaattgccgtcggcgctgccggccgaaggcagcctgcggcccgacacctataaattc
acgcgcggcaccaagcggacggagatcgttcagcaaatggctggcgcgcaggaaaagctg
gtcgaccagatctggcagaaacgtgatccgaacctgacgcttgccaacaagcaggaattc
gtgacgctggcttcgatcgtcgagaaggaaacaggtctggcggatgagcgcgcccatgtc
gcctccgtcttcctgaaccggattggcaagggcatgcgtctgcaatccgacccgacgatc
atctacggtctcttcggcggtgatggaaagccgagcgaccgcccgatcttccagtcggat
ctgaagaaagagacagcctacaacacctatatcatcaagggtttgccgccgacgccgatc
gccaatccgggcagggatgcgctggaagccgttgctaacccctggaagacgcaggacctt
tatttcgtcgccgatggcaccggcgggcatgtctttgccgcgacgctggaagagcacaat
gccaacgtcaaacgctggcgcaagctcgtggcggagaagggcgaggacccgagcgcgatc
gcggtcgacggtcagcctgacgatggcgccgccaccaccacaggttccggcacacagcag
aaaaagaagacgaactga

DBGET integrated database retrieval system