KEGG   Agrobacterium radiobacter: Arad_1676Help
Entry
Arad_1676         CDS       T00850                                 

Gene name
ksgA
Definition
(GenBank) dimethyladenosine transferase
  KO
K02528  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC:2.1.1.182]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.182  16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase
     Arad_1676 (ksgA)
Ribosome biogenesis [BR:ara03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Arad_1676 (ksgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RrnaAD Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ACM26052
UniProt: B9JCD1
Position
1:complement(1328331..1329161)
Genome map
AA seq 276 aa AA seqDB search
MMAALDGLPPLRDVIQRHGLDARKALGQNFLLDLNLTQKVARTAGSLEGVTVFEVGPGPG
GLTRAILALGAAKVIAIERDARCLPALAEIADHYPGRLEVIEGDALKTDFAGMASEGPVK
IIANLPYNVGTQLLVNWLLPGHWPPFWQSLTLMFQKEVGQRIVADEDDDHYGRLGVLCGW
RTQAHMAFDISPQAFSPPPKVTSTVVHLTPRENPIPCSVDKLEKVTQAAFGQRRKMLRQS
LKPLGGETLLQKADIDPQRRAETLSVEEFCRLANCL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
ctgatggctgcactcgacggtctgcccccgcttcgcgatgtgatccagcgccatggcctc
gacgcacgcaaggcactcggccagaatttcctgctcgatctcaacctgacccagaaggtc
gcccgtaccgccggatcgctcgaaggcgtcaccgtcttcgaagtcggaccgggaccaggc
gggctgacacgcgccatcctggcgctcggagccgccaaggtcattgctattgagcgcgac
gcgcgctgcctgccggcgcttgccgaaatcgccgatcactatcccggccggctggaggtc
atcgaaggcgatgcgctgaagacggatttcgcgggcatggcgtcggaaggtccggtgaag
atcatcgccaacctgccctacaatgtcggcacgcaattgctggtgaactggctgctgccg
ggccattggccgcccttctggcaatcgctgacgctgatgttccagaaagaggtcggccag
cggatcgttgccgacgaggatgacgatcactatggccgtctcggtgttctctgcggctgg
cgtacgcaggcacacatggccttcgatatctcgccccaagccttctcgccaccgccgaag
gtaacctcgacggtggtgcatctgacgcccagggagaacccgatcccttgctccgtcgac
aagctggaaaaggtgacgcaagcagccttcggccagcgtcgcaagatgctgcgccaaagc
ctgaagccgctcggcggcgaaaccctgctgcagaaggccgatatcgacccgcaacggcgc
gctgaaacgctctccgtcgaggagttctgcaggctggcgaattgcctctga

DBGET integrated database retrieval system