KEGG   Agrobacterium radiobacter: Arad_1679Help
Entry
Arad_1679         CDS       T00850                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase protein
  KO
K03771  peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ara03110]
    Arad_1679
Enzymes [BR:ara01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Arad_1679
Chaperones and folding catalysts [BR:ara03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    Arad_1679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurA_N SurA_N_3 DUF3874 Rotamase_2
Motif
Other DBs
NCBI-ProteinID: ACM26054
UniProt: B9JCD3
Position
1:complement(1330192..1331142)
Genome map
AA seq 316 aa AA seqDB search
MFSEKTPMRAVLFGAAALIMATFAMPSSDVAFAASEVKVVVNNSVITSGDIAKRINFLKL
QHQKGDLNKLAQEQLVDETLKRAEISRVRMSVSTSDVDSAFGRFAASNKMSPQQLGQILD
KMGVGVDHFKSYIAVSMSWPRVVNARFGSSGGNKLSNDDLVTRMTENKTKPVTTEYFLKQ
IVFVVPQAKRNAILNQRKSEAEASRAKFPGCDQAKVFAATMRDVSVQDLGRVLAPDLPEI
WKPLLEQAKGNTTTPVVTDRGVEYVAICSQRQVNDDVAAAAVFRAEDIGKAGAQGISAND
KKYMDELRSKAQILYR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttctctgaaaagacaccgatgcgcgctgtgctattcggagccgcggcgctgatcatg
gccacgttcgccatgccgagcagcgatgttgccttcgcagcaagcgaggtgaaggtcgtt
gtcaacaattcggtgatcacctcgggcgatatcgccaaacgtatcaacttcctcaaattg
cagcaccagaagggcgacctcaacaagctggcccaggaacagcttgtcgacgagacgctg
aagcgcgctgaaatctcccgcgtacgcatgtcggtatcgacgtcagacgtcgacagcgcc
ttcggccgcttcgccgcgagcaacaagatgtcgccgcagcagcttggtcagatcctcgac
aagatgggcgtcggcgtcgatcacttcaaatcctatatcgccgtctccatgagctggccg
cgcgtcgtcaatgcccgcttcggctcgagcggtggcaacaagctgtcgaatgatgacctc
gtgacccgtatgacggaaaacaagacgaaaccggtcaccacggaatacttcctgaagcag
atcgtcttcgtcgttccgcaagcgaagcggaatgccatcctcaaccagcgcaagtccgag
gcggaagcctcgcgggccaagttcccaggttgcgatcaggcgaaggtctttgccgcgacc
atgcgtgatgtctccgtccaggatctcggccgcgtgctggcccccgatctgcctgaaatc
tggaagccgctgctcgaacaggcaaaaggcaatacgaccaccccagtcgtaaccgatcgc
ggcgtcgagtatgtcgccatttgctcacagcgccaggtcaatgacgacgttgccgcagca
gccgtcttccgcgcggaagacatcggcaaggcgggtgcacagggcatcagcgccaacgac
aagaagtatatggacgaactgcgctccaaggcgcagatcctgtatcgctga

DBGET integrated database retrieval system