KEGG   Agrobacterium radiobacter: Arad_1681Help
Entry
Arad_1681         CDS       T00850                                 

Definition
(GenBank) organic solvent tolerance protein OstA
  KO
K04744  LPS-assembly protein
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_1681
Transporters [BR:ara02000]
 Other Transporters
  Pores ion channels [TC:1]
   Arad_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OstA_C LptC OstA
Motif
Other DBs
NCBI-ProteinID: ACM26055
UniProt: B9JCD4
Position
1:complement(1331352..1333694)
Genome map
AA seq 780 aa AA seqDB search
MAALITGTATCAYIMSPVVAYAQATNNNGGAGAATAPVKVNVPDGSKLILSSNELVYNKD
NQIVTATGAVQINYGGYKMVAQKVEYNQKSGRMTAIGNVELISPDGNRMYGDKMDVTDSF
SDGFVNALRIEMPDNTRMAAEKGERVGGTQMILTKGVYTACQSCSEQGRAPLWQVKAQRV
VQNGVTHTVRLEHARFELFGHPIAYIPWIEVPDNTVKRKSGFLFPSMSVSQHLGFGLKVP
YYYVISPSMDATISATGYTNQGLLLEGEFRQRLENGTHTLRVAGINQMDPSAFTSGTTDA
EHKTRGMISSKADFRINPRWTFGWDVMAQSDNNFSRTYGLDGLNQSTHTNQAYLTGLGKR
NYFDMRAFYYQVQDSDNNDTATKQQAVVYPSIDYHYVDPKSVYGGELSATMNFTRLSRDT
TSVLDATNTLGDSSLNDRYLGLSGDYTRLSTEVQWQRTFTTDQGLVLTPLAALRGDVYGL
DMDAPGAGTYSGNYDTSDYATRGMATAGLEAKYPFLITTSNSTHVFEPIAQLYVRPDEQL
AGQLPNEDAQSFVFDATNLFDRDKFSGFDRVEGGTRANVGWRYTGSFDSGYKLQHIFGQS
FQLAGRNSFAETDLAGVGTDSGLETARSDYVTMFGLTTPQGFSLSQSYRFDEKDFAFRRG
DTTVGFANDVFQTTATYTHIAAQPQYGFTSDQDEIQTRAQIKFKEYWSVFGTVNYDINDS
EITRQGVGLSYEDECTIFSVSFLNKKDSTSASASDWSIGARITFRTLGDVNLGNTQDATF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcccttattacgggcacggctacatgcgcgtatatcatgagcccggtcgtagct
tacgcccaggctaccaacaacaatggcggcgccggtgctgcgaccgctcccgtaaaggtc
aacgtacccgacggctccaagctgatcctttcgtccaacgaattggtctacaacaaggac
aaccagatcgtcaccgccaccggtgccgtgcagatcaactatggcggctacaaaatggtc
gcccagaaggttgagtataatcagaagtccggtcggatgacggcaatcggcaatgtcgag
ctgatcagccccgacggcaatcgcatgtacggtgacaaaatggatgtcaccgacagcttc
tccgacggcttcgtcaatgccctgcgcatcgaaatgccggacaatacccgcatggccgcc
gaaaagggcgaacgtgtcggcggtacgcagatgattctgacgaagggcgtctatacggcc
tgtcagtcctgctccgaacaaggccgtgcaccgctgtggcaggtcaaggcgcagcgcgtg
gtgcagaacggcgtgacgcataccgtccgcctcgagcatgcccgctttgaactgttcggc
catccgatcgcctacattccgtggatcgaagttcccgacaacacggtaaagcgcaagtcc
ggcttcctgttcccgtcgatgagtgtttcccagcacctcggcttcggtctcaaggttccg
tactattacgtcatctcgccgagcatggacgccacgatcagcgccaccggctacacgaac
cagggtctgctgctggagggtgaattccggcaacgccttgaaaacggcacgcatactctg
cgcgtcgccggcatcaaccagatggatcccagtgctttcacgtccggaaccaccgatgcc
gagcacaagactcgcggcatgatctcgtccaaggcggatttcaggatcaatcctcgctgg
accttcggctgggatgtcatggcgcagagcgacaacaacttctcgcgcacctatgggctg
gatggtctcaaccagagcacccataccaaccaggcctacctgaccggtctcggcaagcgc
aattatttcgatatgcgcgccttctactaccaggtccaggactccgacaataacgacacc
gctacgaagcaacaggcggtcgtctacccgagcatcgactatcactatgtcgatccgaag
tcggtctatggcggcgaattgtcggcgaccatgaacttcacgcgcctgtcgcgtgatacg
acatcggtgctcgacgccaccaatactctcggcgactccagcctgaacgaccgctatctc
ggtctttccggagattatacgcgtctcagcaccgaggtgcagtggcaacgtaccttcacc
acggatcaaggtctggtgttgacgccattggcggcgcttcgcggcgacgtctatggcctg
gacatggatgcgccgggagccggtacttattccggcaattacgacacgagcgactatgcc
acgcgtggcatggcgacggccggtcttgaagcgaagtaccccttcctcatcaccaccagc
aacagcacgcatgtgttcgagccgatcgcacagctctatgtgcgtccggacgagcagctt
gccgggcaattgccgaatgaggatgcccagagctttgtcttcgatgcgaccaatctgttc
gatcgcgacaagttctccggtttcgaccgcgtcgaaggtggcacacgcgccaacgtcggt
tggcgctacaccggcagcttcgacagtggctacaagttgcagcatatcttcggccagtcc
ttccagcttgccggccgcaactccttcgcagagactgatcttgccggcgtcggcacggat
tcggggcttgaaaccgcccgttccgactatgtgaccatgttcggcctcaccacgccgcag
ggcttctcgctttcgcagtcctatcgtttcgacgaaaaggatttcgcgttccgtcgcggc
gatactacggtcggcttcgccaacgatgtcttccagaccacggcgacctacacccacatt
gccgcgcagccgcaatatggcttcacctcggatcaggatgaaatccagacgcgcgctcag
atcaagttcaaggaatattggtcggtgttcggtacggtgaactatgacatcaacgatagc
gagatcactcgccagggtgttggcctctcctatgaggacgaatgcacgatcttcagcgtt
tccttcctgaacaagaaggattcgacgagcgcctcggcaagcgactggtcgatcggggcc
cgaatcacgttccgcacgctcggcgacgtcaatctcggcaacacccaggacgccacgttc
tga

DBGET integrated database retrieval system