KEGG   Agrobacterium radiobacter: Arad_1686Help
Entry
Arad_1686         CDS       T00850                                 

Gene name
pepA
Definition
(GenBank) leucine aminopeptidase protein
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00480  Glutathione metabolism
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Arad_1686 (pepA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ara01002]
    Arad_1686 (pepA)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     Arad_1686 (pepA)
Peptidases [BR:ara01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   Arad_1686 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: ACM26059
UniProt: B9JCD8
Position
1:1337082..1338578
Genome map
AA seq 498 aa AA seqDB search
MSVKFEISFAKTVRLNGGLAILLKDADSESPAGAAGADPANVFAKAARIARFTAKGLSSL
DIVAPEGSPVDRIIVIGTGRAKELNAHDWLKLGGAAAARIRNVEKAAIFIDLPGVQAGGK
AAADFALGMLLRAYSFDTYKTKKGDDDDKNGAQKPVKVTIVTPDVAAAKKLFAASEAIAD
GVILARDLVNEPPNVLGPVEFAAKAKALEKLGVEVEILTEREMRRLGMGALLGVAQGSVR
PPRLVIMQWKGGKAKEKPVAFIGKGVVFDTGGISIKPAAGMEDMKGDMGGAAAVTGLMHT
LAARGAKVNAIGVIGLVENMPDGNAQRPGDIVTSMSGQTIEIINTDAEGRLVLCDALWYT
NDRFKPQFMINLATLTGAILVALGNLQAGLFSNDDQLANQLTAAGLVTNERLWRMPLGKD
YDKMIDSKFADMKNTGGRYAGSITAAQFLKRFVQETPWAHLDIAGTAMGSTLDEINQSWG
SGFGVRLLDELVRENYES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaattcgagatttcctttgccaaaacggttcgactgaatggcggtctggcc
atcctgctgaaagacgcagacagcgaatcgccggcgggggccgcaggcgccgatccggcc
aatgttttcgccaaggccgcgcgcatcgcccgtttcaccgccaagggtttgtcgagcctc
gatatcgttgcgcccgaggggtcgccggttgaccggattatcgtgatcggcaccggcagg
gcaaaggaactgaacgcgcatgattggctgaagctcggcggggctgcggccgcgcggatc
cgcaatgtcgaaaaggccgcgatcttcatcgacctgcccggcgtccaagccggtggcaag
gcggctgccgattttgctctcggcatgctgctgcgcgcctatagtttcgacacgtacaag
acgaagaagggcgatgacgacgacaagaacggtgctcagaaacccgtgaaggtgaccatc
gttaccccggatgttgcagccgcaaagaagcttttcgccgcatcggaagcgattgccgac
ggcgttatcctggcgcgcgatctggtcaacgagccgccgaatgtgcttggcccggtcgag
ttcgccgccaaggccaaggcgctggagaaactcggcgtcgaggtggaaatcttgaccgag
cgcgagatgcgccggctcggcatgggtgcgctgcttggcgtggcgcagggttccgtgcgt
ccgccgcgtctggtgatcatgcaatggaagggcggcaaggcgaaggaaaagccggtcgcc
ttcatcggcaagggtgtcgtctttgacaccggcggtatttccatcaagcccgccgccggc
atggaagacatgaagggcgacatgggtggggcggcggccgtgaccggcctgatgcacacg
ctcgcggcccgcggtgcgaaggtcaacgctatcggcgtcatcggcctggtcgaaaacatg
cccgatggtaatgcccagcgtccgggcgatatcgtcacctccatgtccggccagacgatc
gagatcatcaacaccgatgcagaaggcaggctcgtgctctgcgacgcgctttggtacacc
aatgaccgcttcaagccgcaattcatgatcaatctggcgaccttgactggcgctatcctg
gtggcgctcggcaacctgcaggctggcctgttcagcaatgacgaccagctcgcaaaccag
ctcaccgccgccggccttgtcaccaacgaacgcctgtggcgcatgccgctcggcaaggac
tacgacaagatgatcgacagcaagttcgccgacatgaagaacaccggcggccgctatgcc
ggctcgatcaccgccgcgcagttcctcaagcgattcgtgcaggaaacgccctgggcgcat
ctcgatatcgccggcacggcgatgggctcgaccctggacgagatcaaccagtcctggggt
tcgggcttcggcgtgcgcctgctcgacgaactggtccgtgagaactacgaatcgtga

DBGET integrated database retrieval system