KEGG   Agrobacterium radiobacter: Arad_1689Help
Entry
Arad_1689         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GrpB
Motif
Other DBs
NCBI-ProteinID: ACM26061
UniProt: B9JCE0
Position
1:complement(1339097..1339645)
Genome map
AA seq 182 aa AA seqDB search
MSSESGRNFGLGVGNKCVTLAVPNARWQEAYALEAAAIRKALGDISLDIQHIGSTSIPSI
KAKPIIDIAVAVRRFDDGLACIRPMEEIGYCYVGTELVPDDHIFGRDIEGETRTHLVHIV
EYNSTNWNRWLLFRDRLRAHPDLALAYEMLKIDLAGKYADNRAAYTASKKDFIEKVLAAS
GK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggagagcgggcgaaatttcgggctgggcgtcggcaacaagtgcgtgacgctt
gctgtaccgaatgcccgatggcaggaagcctacgcgctcgaagcggcagccattcgcaag
gcgctcggcgatatctccctcgacatccagcatataggcagcacgtcgatcccttcgatc
aaggcaaagccgatcatcgacatcgccgtcgcagtcaggcgcttcgatgatggcttggca
tgcatccggccgatggaggagatcggctactgctatgtcggcaccgagctcgttcccgac
gatcatattttcggtcgtgatatcgaaggcgagacgcgcacgcatctcgttcatatcgtt
gaatataacagcaccaactggaatcggtggcttctatttcgcgacaggctccgtgcacat
ccagatctggcactggcctatgaaatgctgaagatcgacctggccgggaaatatgccgac
aaccgcgccgcctatacggcatcaaagaaagacttcatcgaaaaggttctggctgcgtca
ggcaagtga

DBGET integrated database retrieval system