KEGG   Agrobacterium radiobacter: Arad_1693Help
Entry
Arad_1693         CDS       T00850                                 

Definition
(GenBank) TRAP mannitol/C4-dicarboxylate transporter
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctM
Motif
Other DBs
NCBI-ProteinID: ACM26064
UniProt: B9JCE3
Position
1:1341447..1343213
Genome map
AA seq 588 aa AA seqDB search
MLEFIAVNMAPIMFASLIIFLLIGYPVAFALAANGLLFFWIGVELAPYSGGSINLSWPLL
NALPDRFWGVMSNDTLLAIPFFTFMGIVLERSGMAEDLLDTVGQLFGPIRGGLAYAVIFV
GALLAATTGVVAASVIAMGLISLPIMLRYGYDRRVASGVIAASGTLAQIIPPSLVLIVLA
DQLGRSVGDMYAGALIPGLVLTGLYMLYVLIMSIVRPDSMPALPKEARSLGSGVTSLFVA
LLVCAGVAYAAHVYLTPIYGENADILGATVGVTFIYAIAVVDKTMKFNLMSRLAQQVIIV
LIPPLALIFLVLGTIFLGIATPTEGGAMGAVGALIMALAKGRLSMDVVRSALASTTRLSS
FVLFILIGSRVFSLTFYGVNGHVWVEHLLVSLPGGEVGFLIAVNLLVFVLAFFLDFFELA
FIIVPLLAPAAEKLGIDLIWFGVLLGVNMQTSFMHPPFGFALFYLRSVAAKVPYLDKVTG
KNTAPVTTGQIYWGAVPFVGIQILMVALTIMFPQMVMHYKGAGTGIDPNTIKIDVPGFGT
PGQDNGGGLGLPGLQLPGGNPLQDKPADQNGGQANPPANDLSQPPSFK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgttggaattcattgccgtgaacatggccccgatcatgttcgcttcgctgatcatcttc
ctgctgatcggctatcccgtcgccttcgcgctcgccgccaacggcctgttgttcttctgg
atcggtgttgagctggcgccctattccggcggatcgatcaacctgtcctggccgttgctc
aacgcgctgccggatcggttctggggtgtgatgtcgaacgacacgctgctggcgatcccc
ttctttaccttcatgggtatcgtgctggagcgctccggcatggccgaggacctgcttgat
acggtcggccagctcttcggcccgatccgtggcggccttgcctatgccgtgatcttcgtc
ggcgcgctgctggccgccaccaccggcgttgtcgccgcatcggtcatcgccatgggcctg
atctcgctgccgatcatgctgcgctacggctacgaccggcgggttgcctccggcgtcatc
gctgcatcaggtacgctggcgcagatcattccaccgtcgctggtgctgatcgtgctggcg
gaccagctcggccgctcggttggtgacatgtatgccggtgctctgatccccggcctggtg
ctgaccggcctctacatgctctatgtgttgatcatgtcgatcgtccggccggactccatg
ccggcgctgccgaaggaggcgcggtcgcttggttcgggcgtgacctcgctcttcgtcgcg
ttgctggtctgcgccggtgtcgcctatgccgcccatgtctatctgacgccgatctacggg
gaaaacgccgatattctcggcgcaaccgtcggcgtgacgttcatctatgccattgccgtc
gtcgacaagacgatgaagttcaacctgatgtcgcggttggcgcagcaggtgatcatcgtg
ctgatcccgccgctggcgctgatcttcctcgtgctcggcaccatcttcctcggcatcgcg
acgccgacggaaggcggcgcgatgggggcggtgggtgctctgatcatggcgttggccaag
ggtcgcttgagcatggacgtggtccgctcggcgctcgcgtcgacgacgcggctttcgtcc
ttcgtgctgttcatcttgatcggctcgcgcgtgttctcgctgacgttctacggcgtcaac
ggccatgtctgggtggagcatctgctggtatcgctgccgggcggcgaagtcggcttcctg
attgccgtcaacctgctggtcttcgtgctggccttcttcctcgatttcttcgagctggcc
ttcatcatcgtgccgctgctggcgcccgccgccgaaaagctcggtatcgacctgatctgg
ttcggcgtcttgctcggtgtcaacatgcagacgagcttcatgcatccgcccttcggcttc
gcgctattctatctgcgctcggtcgcggcaaaggtgccctatctcgacaaggtgacgggc
aaaaacaccgcgccggtgacgacagggcagatctattggggtgccgtgcccttcgtcggt
atccagatcctgatggtggcgctgaccatcatgttcccgcaaatggtcatgcactacaaa
ggcgcgggcacgggcatcgatccgaatacgatcaagatcgacgtgccgggcttcggcact
cctggccaggacaatggcggcggtctcggtctgccaggcctgcagctgccgggcggcaat
ccgctgcaggacaagccggccgatcagaatggcgggcaggccaatccgccggccaacgat
ctcagccagccgccatcgtttaaatga

DBGET integrated database retrieval system