KEGG   Agrobacterium radiobacter: Arad_1694Help
Entry
Arad_1694         CDS       T00850                                 

Definition
(GenBank) TRAP mannitol/C4-dicarboxylate transporter
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctP UCR_Fe-S_N CytB6-F_Fe-S
Motif
Other DBs
NCBI-ProteinID: ACM26065
UniProt: B9JCE4
Position
1:complement(1343299..1344405)
Genome map
AA seq 368 aa AA seqDB search
MDRRSFLRKAGVAGAGSVAAAALAAPAIAQSNPKINWRLASSFPKSLDTIYGGAEVLSKY
VSEATDGNFTIQVFAAGEIVPGLQAADAASAATVEACHTVSYYYWGKDPVWALGAAVPFA
LNARGMNAWQYHGGGIDLFNEFLATQGLVGFPGGNTGVQMGGWFRKEINTVADLKGLKMR
IGGFAGKVVERLGVVPQQIAGGDIYPALEKGTIDAAEWVGPYDDEKLGFYKVAPYYYYPG
WWEGGPTVHFMFNKAAYEGLPKAYQSLLRTAAQATDANMLQKYDYLNPAAIKRVVAEGAK
LRPFSTEILNACFEKSNEVYAEMEASNPTFKKIWESIKAFRGQHYLYAQVAEYSYDVYMM
TQQRAGKI
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcgttcatttctgaggaaagccggcgttgccggtgcgggctcggttgccgcc
gcggcccttgcggctccggccattgctcagagcaatccgaaaatcaactggcgcctggcg
tcatcattcccgaagtcgctcgatacgatctatggcggcgcggaagtgctgtcgaaatat
gtgtcggaagcgacagacggcaatttcaccatccaggtctttgctgccggtgaaatcgtg
cccggcctacaggctgccgatgcggcgtcggcggccacggtcgaagcctgccacacggtc
tcctattattattggggcaaggatccggtctgggcactgggagccgccgttcccttcgcg
ctcaacgcccgcgggatgaacgcctggcagtatcacggcggcggcatcgatctcttcaac
gaattcctggcaacgcaagggctggtcggttttcccggcggcaataccggcgtgcagatg
ggcggctggttccgcaaggaaatcaacaccgtcgccgatctcaagggcctgaagatgcgt
atcggcggctttgccggcaaggtggtggagcgccttggcgtcgtgccgcagcagatcgcc
ggcggcgacatctatccggccctggaaaagggcacgatcgatgcggctgaatgggtcggc
ccctatgacgacgaaaagctcggcttctataaagtcgccccctattactactatcccggc
tggtgggaaggcggcccgaccgtgcatttcatgttcaacaaagcggcctatgagggcctg
ccgaaggcctatcagtcgctgctgcgcaccgcagcccaggcgaccgacgccaacatgctg
cagaaatacgactacctgaacccggccgccatcaagcgcgtcgttgccgagggcgccaag
ctacgtccgttcagcacggaaatcctgaacgcctgcttcgaaaagtcgaacgaggtctat
gccgaaatggaagcctcgaacccgaccttcaagaagatctgggaatcgatcaaggccttc
cgcggccagcattacctctacgcccaggtcgcggaatacagctacgacgtctacatgatg
acacagcaacgcgcgggaaagatctga

DBGET integrated database retrieval system