KEGG   Agrobacterium radiobacter: Arad_1697Help
Entry
Arad_1697         CDS       T00850                                 

Definition
(GenBank) polysaccharide deacetylase protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 E1-N
Motif
Other DBs
NCBI-ProteinID: ACM26067
UniProt: B9JCE6
Position
1:complement(1346732..1347622)
Genome map
AA seq 296 aa AA seqDB search
MTYRLLLAGLAVSLSLAGCATKPGGEASLKTSFAAEEPQRKALKANDPIDMEPSKWASTD
AETRETSDEGRSHTLAGRTLEVSSLQELKLADREVILSFDDGPAPGKTERILATLDRFGV
KATFMMVGEMAQAHPETALKVVAAGETIGSHTFRHADLDKMSFDMAMAEIMRGKNAVAKV
VGTDVPFFRFPYLADSRRLRAAVTMRDLVIMDVDVDSKDYFTLSPAAVAARTMNELRKRG
RGIVLMHDIHQRTATMLPALLTRMEKEGYKVVTLKYKAAPKPTSDLVAQADIKMVR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacctaccgtctcctattggccggccttgccgtgtccctgtcccttgccggttgcgcc
acgaagccagggggcgaggcttcgctgaagacgagctttgccgccgaagaaccgcaacgc
aaggcgttgaaggccaacgaccccatcgacatggagccgtccaaatgggcgagcaccgat
gctgagacgcgagaaacaagcgacgaaggccgctctcacacgctcgccgggcgcacgctg
gaagtctcctcgctgcaagagctgaaactcgccgacagggaagtcatcctgagcttcgat
gacggccccgcccccggcaagacggagcgcattctcgcaaccctcgacaggttcggcgtc
aaggcgaccttcatgatggtcggcgagatggcgcaggcgcatccggagacagcactcaag
gtcgttgctgcaggcgaaaccatcggcagccacaccttccgtcatgccgatctcgacaag
atgagcttcgacatggcgatggccgagatcatgcgcggcaaaaacgccgttgcaaaggtc
gtcggcacggatgtccccttcttccgcttcccttatcttgctgattccaggcgcctgcgc
gcggccgtcaccatgcgtgatcttgtgatcatggatgtggatgtcgacagcaaggactat
ttcaccctgtcgcccgccgccgtcgcagcgcgcaccatgaacgagctgcgcaagcgcggg
cgcggcatcgtcctgatgcacgacatccaccaacgcaccgccaccatgctgccggccctt
ctgacacgcatggaaaaagagggctacaaggtcgtgacgctgaagtacaaagctgccccc
aagccgacttcggatctggtcgcccaggccgatatcaagatggtgcgctga

DBGET integrated database retrieval system