KEGG   Agrobacterium radiobacter: Arad_1701Help
Entry
Arad_1701         CDS       T00850                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ara  Agrobacterium radiobacter
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB DinB_2 DUF664
Motif
Other DBs
NCBI-ProteinID: ACM26070
UniProt: B9JCT3
Position
1:complement(1350335..1350844)
Genome map
AA seq 169 aa AA seqDB search
MLRHFGMFAHYNRWANTLLYDAAAQLSDAEFHENRGAFFGSLRNTLNHLLVADRMWMHRF
TGTGEAAAILNAIPHDALADLRAARAAEDQRIIDWVETLDDARLAADITYSPVTRPGAIT
HPLRAAVAQFFNHQTHHRGQCHMTLTALGKPSLELDLIYFLRGEGRRWM
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgctcagacacttcggaatgtttgcccactacaatcgctgggccaataccctgctatat
gatgcggctgctcagctcagcgatgcggaatttcacgaaaaccgcggcgccttcttcggc
tccttgcgcaacacgctcaaccatctgctggtcgcagaccgcatgtggatgcaccgtttc
acaggcaccggcgaggccgcggcgatactgaacgccattccgcatgacgctctcgccgat
ctccgtgccgcgcgcgcggccgaggaccagcgtatcatcgattgggtcgaaacactcgac
gatgcccggcttgcagcagacatcacctattcaccggtcacccggccgggcgccattacc
catccgttgagagccgcggtcgcacagttcttcaaccatcagacccatcaccgcggccaa
tgtcacatgacgctgacagccttgggcaaaccgtcgctggaactcgacctgatctacttc
ctgcgcggagaaggaagacgctggatgtaa

DBGET integrated database retrieval system